PRGDB00074432 (Psi.5795)

From PRG Wiki
Revision as of 16:34, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Psi.5795
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148905893 (EF676190)
Gene Class Unknown
Domain Type
Gene Species Picea sitchensis

Comment?

Picea sitchensis clone WS02718_A24 unknown mRNA

DNA Sequence

CCGATGCCCATTACCATTCCCTTTCCCCTGTGTTTTTGAATTAGGTCTCAGCCTTCCCAGTTCCTTGGAATTGCGATTGGGGAGGTAAATCCCTGGGAAGGAGTTGCAGGATCAAACACTCGGTTTTTTGGATTTCAAGATCCAAAGTAAAAGATGGATCCTTTCTATGGACCAGGGAGAAATCAACTATTTGTTCCGGGGCCTGTCAATATTCCGGAACCTGTTCTGCAGGCTATGAATAGAAACAATGAGGACTACCGCGCTCCACCAGTGCCAGCTCTCACAAAGAAACTTCTTGCTGACGTACCGAAAATATTCAAATCCACCACAGGCACTCCTTTCTTATTTCCTACTACGGGTACTGGTGCTTGGGAAAGTGCTCTTACAAACACACTGTCACCACGAGATCGAATCATCTCTTTTGAGATGGGCCAGTTCAGTCTTCTGTGGATTGATCAAATGAAACGCCTCAACTTTGATGTTGATGTTGTACACTGTGAATGGGGGACAGGGGTGGATCTTGAGATACTAAGGACAAAGCTTGAAGCAGATAAGGAACATAAAGTAAAGGCTATTTGCTGTGTTCACAATGAGACTGCAACGGGCGTCACAAACAATTTGGCAGCTATAAGGACGGTGATCGATGATTGCATGCATCCTGCTTTGTTTCTGGTGGATGGCGTGTCTTCTGTATGTGCCATTGATTTCCGTATGGATGAATGGGGAGTGGATGTAGCGCTAACAGGTTCTCAAAAAGCTCTGTCCTTGCCAACAGGTCTTGGTATTGTCTGTGCAAGCCCAAAGGCCTTAGAAGCAACAAAGACTGCAAAGTCGTTGAGGGTATTTTTTGACTGGAACGACTATTTGAAGTTCTATAAGTTGGGGACGTATTGGCCCTACACACCATCAATTCAACTCCTATATGGACTACGGACAGCATTAGACCTTATATTTTTGGAAGGCTTAGATAACGTCATTGCAAGGCACAGTCGCTTAGGAAGGGCAACAAGGCTTGCTGTGGAAGCATGGGGGTTGAAGAACTGCACTCAAAGGGAGGAATGGTACAGTGACACTGTTACAGCAGTAGTTATTCCCCCTTATATTGACAGTACAGAGATTGTGAAAAGGGCGTGGAAGAGATACAATTTGAGTTTGGGATTGGGGCTCAATAAAGTGGCAGGCAAGGTGTTCAGAATAGGACACCTGGGAAACCTGAATGAGACATTTTATTGAGGGAGAGTTTTTAAGTAATTGCCTAGCTTACAATCACTTGCAACGAGATCATTGGAAAGTCATTTCAGTTGCAACTGTTGGGATGCCTCAGTGGCGTTGAAATGGTATTGAAGGATATTGGATATCCGGTGAAATTGGGCAGTGGAGTTGCAGCAGCTGCAGCTTACCTCCAGATGACTACTCCCTTAATAGCATCCAGGGTGTGATATTTATTTCATTTAGTTCTTCGATGTTCAACCTGTAAAAAATATTTCAGACTCTGAGAAACAATCTTTTCTGCAAGCCATGAATTTCAGTCTTTGTTTTTAAATGATGAAAGCACGTGATTTATATGATTTCTTTCCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Psi.5795 translated coding region predicted by ESTScan from UniGene Psi.5795

MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNETFYWGEFLSNCLAYNHLQRDHWKVISVATVGMPQWRXNGIEGYWISGEIGQWSCSSCSLPPDDYSLNSIQGVIFISFSSSMFNL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-357 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNET

HMMPanther: PTHR21152
1-357 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNET

superfamily: SSF53383
IPR015424
7-375 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNETFYWGEFLSNCLAYNHLQR

HMMPfam: PF00266
IPR000192
12-325 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKR

Gene3D: G3DSA:3.40.640.10
IPR015421
21-256 no description
Pyridoxal phosphate-dependent transferase, major r

PEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTGTPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTGVDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL

Seg: seg
58-71 seg

TTGTPFLFPTTGTG

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
257-356 no description
Pyridoxal phosphate-dependent transferase, major r

YGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox