PRGDB00075179 (Pth.5118)

From PRG Wiki
Revision as of 16:57, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pth.5118
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224063574 (XM_002301176)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGATCCTTCAACAACACACTATCCTCTTCTTAGCAATCTTTGCTATTTCATTAATCGAAGCTCATGCTTCCATCAAGTTCAGATGCAACAGAACATGCGGCACCAACCATCTTCCATACCCTTTTGGATTCTCTGCCGATTGTGATATCCATTTAAATTGTAGCCCACATGGTGAAATGCTTATCAATGAGTTTCCAGTCCAGATTGTAGGCCAAAATTCAATAAAGATCATTCTTGAACCCAAATGTAACCGTCCTCTCGAAGCCCTCGACAATCTTTTTACCAAAAACTATGCTCCAAAATCAACAAACGCAATTCTTTTACACAACTGTACCTCTGCAGTTTCGCCATGCAATATACCTTCTATAAACGTGCAGACTCATTTCGAGTCACTTAAATGTTCAAATAACAGCAGCTTAAGTTGTTTCTCTAAGGAGGTTACAGCAAACGGTTTCTTTGATTATAACATGGCCAATATTAGCCAGTGCCAGTATTTTTTGTCATCAATATCGGCAGAGTCTTTCACTGGTTCTGGTGTTTCCTTAGAGATTCAGATGATGGAGCTATGGTGGTGGCTTCAAGGGGACTGCCGTTGCTCTAAGGATGCCATTTGTACTCAAGTTGAATCGCCTGCAGGGTCAGGATTTCGGTGCCAGTGCAGAGACGGGCTAATTGGTGATGGATATCTTGCCGGGGTTGGCTGCCGGAAAGGTAGTTTTCTCGATGTCAAAGCCTCTGCAGGTTGCAATCCTGCAAAGTATTTGTCTGGCCAATGTGGAGGAGGGTCTGGAGCTGCTGTTTTACTTGGAGGCGTTGTAGCTGGAGTAGGGGTCAGTCTGGGTCTATTTTGCTGTCTCGTACGGAGGAATTCCGCGTCAAAAGCCAAAAGCTTCAGAAAACTCCACCTATCTGAAGCTGCAGACATCAACATTCCCATCTATCCCTACAAAGAAATAGAGAAGGCCACAAATAGTTTCTCTGAGAAACAAAGGATTGGAACTGGGGCTTATGGAACTGTCTATGCTGGTAAACTCAACAGTGATTCATGGGTTGCCATTAAGAGGATCAAACATGGAGATATGGACAACATTGAGCAAGTGATGAACGAAATCAAGCTCATTTCTTCTGTGAGTCACCCGAATTTAGTCCGCCTCTTAGGTTGCTCCATAGAAAATGGTGAGCAAATTCTTGTCTATGAATTCATGCCGAATGGGACATTGTGCCAGCATTTACAAAGAGAGAGAGGTGATGGACTTGACTGGCCTGTTCGCCTCGCTATTGCTGCGGATACTGCTAAAGCTATAGCCCATCTCCACTCTGCTATGGATCCCCCGATATATCATAGAGATATCAAGTCGAGCAACATACTCTTAGACTACCACTTCAGGTCCAAAGTTGCAGATTTTGGTCTTTCCAGACATGGCATGACTGAAATATCACACATCTCTACTGTCCCGCAAGGAACTCCAGGCTACCTTGATCCTCAGTACCATCTAAACTTCCATCTTTCGGACAAAAGTGACGTTTATAGCTTTGGTGTTGTTCTCGTTGAGATCATAACAGCAAAGAAGGTGGTGGACTTTTCCAGGCCTCAGAATGAAGTGAATTTGGCTGCTCTTGCCACTGATAGGATTGGCAGGGGGAGATTGGATGAGATAATCGATCCGTTCCTTGATTTACATAGTGATGCTTGGACCTTTTCTTCAGTGCATAAAGTGGCAGAAGTGGCATTTAGGTGCCTTGCATTTCATAAAGACATGAGGCCTTCAATGATGGAAGTTGCAGCAGAACTAGAGCAAATACTGCTTAGTAGATGGGCTTCTTCAGAGGAAACAAATTGCGCAATCTCATTAGATTTTTCCCCTTGCTCTTCTTCATCTAATGTCAGCGACAAGCCTCTAAACTCCACAGTaaaaaaaaCAGAAATAGAGAGAAGAGGTTTGTTTGTGCTGCAGACACAGACCAGTAAAAAGTCAACGGAAAGGGCCAATCATAATTCACCTGTTTCTGTCCAAGATCCATGGTTAAGTGAAAAAAGCTCACCTTCTTCAAGCAATTTGCTAAATAACGTTATAGTTAAGTGA


Protein sequences

Name Description Sequence
Pth.5118 translated coding region predicted by ESTScan from UniGene Pth.5118

MILQQHTILFLAIFAISLIEAHASIKFRCNRTCGTNHLPYPFGFSADCDIHLNCSPHGEMLINEFPVQIVGQNSIKIILEPKCNRPLEALDNLFTKNYAPKSTNAILLHNCTSAVSPCNIPSINVQTHFESLKCSNNSSLSCFSKEVTANGFFDYNMANISQCQYFLSSISAESFTGSGVSLEIQMMELWWWLQGDCRCSKDAICTQVESPAGSGFRCQCRDGLIGDGYLAGVGCRKGSFLDVKASAGCNPAKYLSGQCGGGSGAAVLLGGVVAGVGVSLGLFCCLVRRNSASKAKSFRKLHLSEAADINIPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEVAAELEQILLSRWASSEETNCAISLDFSPCSSSSNVSDKPLNSTVKKTEIERRGLFVLQTQTSKKSTERANHNSPVSVQDPWLSEKSSPSSSNLLNNVIVK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF852
96-666 PTHR24420:SF852

KNYAPKSTNAILLHNCTSAVSPCNIPSINVQTHFESLKCSNNSSLSCFSKEVTANGFFDYNMANISQCQYFLSSISAESFTGSGVSLEIQMMELWWWLQGDCRCSKDAICTQVESPAGSGFRCQCRDGLIGDGYLAGVGCRKGSFLDVKASAGCNPAKYLSGQCGGGSGAAVLLGGVVAGVGVSLGLFCCLVRRNSASKAKSFRKLHLSEAADINIPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEVAAELEQILLSRWASSEETNCAISLDFSPCSSSSNVSDKPLNSTVKKTEIERRGLFVLQTQTSKKSTERANHN

HMMPanther: PTHR24420
96-666 PTHR24420,FAMILY NOT NAMED

KNYAPKSTNAILLHNCTSAVSPCNIPSINVQTHFESLKCSNNSSLSCFSKEVTANGFFDYNMANISQCQYFLSSISAESFTGSGVSLEIQMMELWWWLQGDCRCSKDAICTQVESPAGSGFRCQCRDGLIGDGYLAGVGCRKGSFLDVKASAGCNPAKYLSGQCGGGSGAAVLLGGVVAGVGVSLGLFCCLVRRNSASKAKSFRKLHLSEAADINIPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEVAAELEQILLSRWASSEETNCAISLDFSPCSSSSNVSDKPLNSTVKKTEIERRGLFVLQTQTSKKSTERANHN

superfamily: SSF56112
IPR011009
296-598 Kinase_like
Protein kinase-like domain

KSFRKLHLSEAADINIPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEVAAEL

Gene3D: G3DSA:3.30.200.20
311-387 G3DSA:3.30.200.20

IPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLG

ProfileScan: PS50011
IPR000719
326-603 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEVAAELEQILL

HMMPfam: PF00069
IPR017442
327-594 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SEKQRIGTGAYGTVYAGKLNSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEV

PatternScan: PS00107
IPR017441
332-354 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGTGAYGTVYAGKLNSDSWVAIK

Gene3D: G3DSA:1.10.510.10
388-608 G3DSA:1.10.510.10

CSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMMEVAAELEQILLSRWAS

PatternScan: PS00108
IPR008271
446-458 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox