PRGDB00075187 (Pth.5382)

From PRG Wiki
Revision as of 16:57, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pth.5382
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224082491 (XM_002306678)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGGACGAAACCGCCTCTTATGACCCGACTATAAACCACATCTCCATGGAAGAGCTAAAAGTCTCCACCAAGAACTTCTCCACCGATTTAATCATCGGCGATGGCAGTTTCGGCTTGGTTTATAAAGCTGCACTCTACAACGGCTCCACGGTTGCTATTAAAAAGCTTGACCCGGACGCTTTTCAAGGTTTTCGTGAGTTTCGCGCCGAGATGGAGACTCTAGGTCAGTTACGCCATGGAAATATTGTCAAGATTCTCGGGTATTGTGTTTCGGGCCGGGACCGGGTTTTAATTCTGGAGTTCGTTGAAAGAGGGAGTCTTGACCAGTGGATTCACGACACATCATCAACGGATAACGATCACTTTGATAAGTTCCCATTACCCTGGGAGACGAGGATCAAGATAGTTATGGGCGTGGCCAATGGGCTTGCTTATTTGCATGGGCTTGATACTCCCATTATTCATAGGGATATTAAGGCTAGTAACGTTTTGTTGGACGCGAGCTTTCAGGCCCATATCTCTGATTTTGGGCTTGCCCGTAGAATCGAGGCGTTGCGCTCGCATGTGTCCACGCAGGTTGCGGGGACTTTTGGGTACATGCCACCGGAGTATAAAGACGGTTTCATCGGAGCGACGGTGCAGGCAGACGTTTACAGTTTTGGGATTTTGATGTTTGAGATTGCGACCGCAGAGAGGCCGGATTTGCCTAAGGTGGTGGAGAAGAAAGAGGTGGGGTTTATTGAATGGGTTAAGAAGATGTTGGGGCAAGATCGTCATATGGAGATGTTGGATTGTAATATGCCGAAGGAGGGTTTGAGTGGAGATGATCAAGTTAAGGAATATTTTAGGATTGCTTCTTTGTGCACAGAGGAGTTTATGGGAGATAGGCCCGCCATGAGTGAAGTTGTGGATTTGTTGAAAAAACTTTCATAGGTTCTTCAAGATTTTACTTCTTGTAGTGGCCATGTATGACCAAGTTGAGTtaaataaaattaaaacgaaaaaaTATTAGTAATTTCTTC


Protein sequences

Name Description Sequence
Pth.5382 translated coding region predicted by ESTScan from UniGene Pth.5382

MDETASYDPTINHISMEELKVSTKNFSTDLIIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFVERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVDLLKKLS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
7-102 G3DSA:3.30.200.20

YDPTINHISMEELKVSTKNFSTDLIIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFV

HMMPanther: PTHR24420:SF361
8-310 PTHR24420:SF361,PROTEIN KINASE FAMILY PROTEIN

DPTINHISMEELKVSTKNFSTDLIIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFVERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVDLLKKLS

HMMPanther: PTHR24420
8-310 PTHR24420,FAMILY NOT NAMED

DPTINHISMEELKVSTKNFSTDLIIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFVERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVDLLKKLS

superfamily: SSF56112
IPR011009
11-306 Kinase_like
Protein kinase-like domain

INHISMEELKVSTKNFSTDLIIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFVERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVDLL

ProfileScan: PS50011
IPR000719
26-310 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSTDLIIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFVERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVDLLKKLS

HMMPfam: PF07714
IPR001245
31-304 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

IIGDGSFGLVYKAALYNGSTVAIKKLDPDAFQGFREFRAEMETLGQLRHGNIVKILGYCVSGRDRVLILEFVERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVD

PatternScan: PS00107
IPR017441
32-55 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGDGSFGLVYKAALYNGSTVAIKK

Gene3D: G3DSA:1.10.510.10
103-306 G3DSA:1.10.510.10

ERGSLDQWIHDTSSTDNDHFDKFPLPWETRIKIVMGVANGLAYLHGLDTPIIHRDIKASNVLLDASFQAHISDFGLARRIEALRSHVSTQVAGTFGYMPPEYKDGFIGATVQADVYSFGILMFEIATAERPDLPKVVEKKEVGFIEWVKKMLGQDRHMEMLDCNMPKEGLSGDDQVKEYFRIASLCTEEFMGDRPAMSEVVDLL

PatternScan: PS00108
IPR008271
153-165 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox