PRGDB00075188 (Pth.5414)

From PRG Wiki
Revision as of 16:57, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pth.5414
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224063934 (XM_002301273)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGCCATCTCGCCACCTCCGATCTCTATCAGAaccaccaccaccaccactccaccaccacATCCGCCTCCTCCCTCCACTCCTTGCTGGAACACTAACGCTCATTCTCATTTTCCTTATTGTACTTGTAGTCTTGCTCTATCGCAAAATCACGCGCAACCGTACAGCTCCAATTACAAGATCTCCAAATcaccaccaccaccaccaATGCCGCTGCTACTCCTACTCTCTCCTCCGCCGTGCAACTTCCTCATTCTCACCATCCAACCGCCTCGGACACGGCGGATTTGGATCAGTCTACAAAGCTACACTTCCTAACACTAATCAACATTTAGCTGTTAAATTGATGGACCAAAACGGTTCTCTTCAAGGTGAGAGAGAGTTCCATAACGAACTCTCAATTGCTTCTTGTTTAGATTCTCCTAACATTGTGTCCCTCCTTGGCTACTCATGTTCGCGAAAGAAGAAATTAGTTTTAGTCTATGAGTTGATGGAGAATagaagcttacaagaagccttgtttgataggaaatgtgaagAGTTGATGAATTGGAAGGTTAGATTTGAGTTAGTGATTGGTGTAGCTAAAGGACTTGAGTATTTGCATCATTTTTGTAGTCCTCCGGTGATTCATGGGGATATTAAACCTGGTAATATCTTGCTTGATTCGTGTTTTAACGCGAAAATTGGAGATTTTGGTCTAGCGAGATTGAAGATTGAGGAGAGTAATGGTTTCCTGGAGAAGAAAGAGGGTTTTGGAGAGGATAATGGGTCGATTTTGGAGGAGACGGAGAGTGTGGCAAGTGGGTGCGGAGAGAGTGGGATTTTAGACGTTGGTGGTGTTGTGAGATCGCCGGAGAGTTTTGGTGTTAGGGTTTTGGATTCGGATGCGTCACCGGAGATGTTTTCAGTGGTTTCGCCGGAGGTTGGGGTGGATAAGGGGAGTGTATCGGAGGCGGGTTTTGATAAGATGAGTGTTGATAGTGGAAGAGATTTGATTGGTGGAGGGAAGAAAAGTGGGTCGAGGAGGGATTGGTGGTGGAAACAGGATAACGGAGGTGGATCGGAGTCGGGGAGAGTGAAGGATTATGTGATGGAGTGGATTGGAAGTGAGATTAATAAGGAGAGACCTAAGCAAGAATGGAATGCAGCGTCTCCAATTTCCAatgaggaaagaatgaagaagaaggagaagaatagaaagcctagagagtggtggaaggaggagTTTTGTGAGGAGCTGACGAAGAAAAAGAAGAAGAGAGGACTTAGTTCGAGTAATAGTGGAGATTTATGGTGGCAAAAGGATGATGATGGGGTGCAAGAAAGGAAGAAGAAGAGGAAGAGCAAGGGTAGTAGAGGTAGTATGGATCGGTGGTTGGATGGTTTCAGTGGTGAATTTAGAAATGGGAGAAGAAACAGCCAGGATTGGGCTAGTGGAGAGATCCCCAAGAGTGGTGGTATTAGTAGCACGCCTAGCATGAGAGGAACGGTGTGTTATATTGCTCCTGAATATGGTGGAGGTAGCCTGTTATCAGAGAAGTGTGATGTTTATAGTTTCGGTGTTCTGCTCCTTGTGGTGGTTTCTGGGAGAAGACCGCTGCAAGTAACCGCCTCACCAATGTCAGAATTTGAGAGGGCTAATCTAATCTCTTGGGCCAGGCAACTTGCATACAATGGGAAGCTATTGGATATTGTTGATACTTCAGTGCATTCGTTGGATAAGGATCAGGCATTGCTTTGCATTACAATTGGTCTACTGTGTTTGCAGAAATCGCCTAGCAAACGGCCCACGATGAAAGAAATTGTGGGGATGCTTTCTGGGGAGGCAGAGCCACCCCACTTGCCATTTGAATTTTCACCATCACCGCCGTCCAATTTTCCATTCAAATCCCGAAGAAAGGCTCGGTGA


Protein sequences

Name Description Sequence
Pth.5414 translated coding region predicted by ESTScan from UniGene Pth.5414

XAISPPPISIRTTTTTTPPPHPPPPSTPCWNTNAHSHFPYCTCSLALSQNHAQPYSSNYKISKSPPPPPMPLLLLLSPPPCNFLILTIQPPGHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGMLSGEAEPPHLPFEFSPSPPSNFPFKSRRKAR

Domains

Domain Start-End Description Sequence

Seg: seg
3-28 seg

ISPPPISIRTTTTTTPPPHPPPPSTP

Seg: seg
64-80 seg

SPPPPPMPLLLLLSPPP

superfamily: SSF56112
IPR011009
69-634 Protein kinase-like (PK-like)
Protein kinase-like domain

PMPLLLLLSPPPCNFLILTIQPPGHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGMLSGEAEPPHLPFEFSPSPPSNFPFKSRRK

ProfileScan: PS50011
IPR000719
85-617 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ILTIQPPGHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGMLSGEAEPPHLPF

HMMSmart: SM00219
IPR020635
85-606 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ILTIQPPGHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGML

HMMSmart: SM00220
IPR002290
85-606 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ILTIQPPGHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGML

HMMPfam: PF00069
IPR017442
91-242 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PGHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEES

HMMPanther: PTHR24420:SF440
92-628 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGMLSGEAEPPHLPFEFSPSPPSNFP

HMMPanther: PTHR24420
92-628 FAMILY NOT NAMED,FAMILY NOT NAMED

GHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELMENRSLQEALFDRKCEELMNWKVRFELVIGVAKGLEYLHHFCSPPVIHGDIKPGNILLDSCFNAKIGDFGLARLKIEESNGFLEKKEGFGEDNGSILEETESVASGCGESGILDVGGVVRSPESFGVRVLDSDASPEMFSVVSPEVGVDKGSVSEAGFDKMSVDSGRDLIGGGKKSGSRRDWWWKQDNGGGSESGRVKDYVMEWIGSEINKERPKQEWNAASPISNEERMKKKEKNRKPREWWKEEFCEELTKKKKKRGLSSSNSGDLWWQKDDDGVQERKKKRKSKGSRGSMDRWLDGFSGEFRNGRRNSQDWASGEIPKSGGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGMLSGEAEPPHLPFEFSPSPPSNFP

Gene3D: G3DSA:3.30.200.20
92-164 no description

GHGGFGSVYKATLPNTNQHLAVKLMDQNGSLQGEREFHNELSIASCLDSPNIVSLLGYSCSRKKKLVLVYELM

PatternScan: PS00108
IPR008271
209-221 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHGDIKPGNILL

Seg: seg
389-409 seg

NEERMKKKEKNRKPREWWKEE

Seg: seg
443-455 seg

RKKKRKSKGSRGS

Gene3D: G3DSA:1.10.510.10
486-633 no description

GGISSTPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIVGMLSGEAEPPHLPFEFSPSPPSNFPFKSRR

HMMPfam: PF00069
IPR017442
490-603 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

STPSMRGTVCYIAPEYGGGSLLSEKCDVYSFGVLLLVVVSGRRPLQVTASPMSEFERANLISWARQLAYNGKLLDIVDTSVHSLDKDQALLCITIGLLCLQKSPSKRPTMKEIV

Seg: seg
522-528 seg

VLLLVVV

Seg: seg
612-631 seg

PPHLPFEFSPSPPSNFPFKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox