PRGDB00075554 (Ptp.5042)

From PRG Wiki
Revision as of 17:09, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ptp.5042
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 23974198 (BU815368)
Gene Class Unknown
Domain Type
Gene Species Populus tremula x Populus tremuloides

Comment?

N041A03 Populus bark cDNA library Populus tremula x Populus tremuloides cDNA 5 prime, mRNA sequence

DNA Sequence

GGGGGGAAGATGGACTACTTTTATGGACCAGGAAGGAATCATCTGTTTGTTCCAGGGCCGGTTAATATTCCTGAATCAGTCCTGAGGGCAATGAACAGGAACAATGAGGATTACCGTTCTCCAGCAGTTCCAGCAATGACTAAAACTCTTCTTGAGGATGTGAAGAAGATTTTCAAGACTACCTCAGGAACTCCATTTATCATCCCAACCACAGGCACTGGTGCATGGGAGAGTGCACTTACCAACACTTTGTCTCCTGGAGATCGAACTGTATCTTTCCTGATAGGCCAATTCAGTTTGCTCTGGATTGATCAGCAAAAACGCCTTGGTTTCAATGTTGATGTTGTAGAGAGCGACTGGGGTCAAGGTGCCAACCTTGACATCCTGGCCTCAAAACTTGCGGAAGATACTGCGCATACCATTAAGGCTGTTTGCATTGTTCACAATGAGACAGCAACTGGAGTTACCAACAACTTGGCTAAAGTTAGAAAAATACTTGATGACTACAGGCATCCAGCTCTCTTCCTTGTTGATGGGGTGTCCTCCATTTGTGCTCTTGATTTCCGCATGGATGAATGGGGAGTAGATGTGGCTTTAACCGGCTCTCAAAAGGCTCTCTCTCTTCCTACCGGGATGGGTATCGTGTGTGCAAGCCCCAAAGCTCTTGAGGCATCTGAAACTGCCAAGTCGTTTAGAGTATTCTTTGA


Protein sequences

Name Description Sequence
Ptp.5042 translated coding region predicted by ESTScan from UniGene Ptp.5042

GGKMDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASETAKSFRVFFX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
4-235 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASETAKSFRVFF

HMMPanther: PTHR21152
4-235 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASETAKSFRVFF

superfamily: SSF53383
IPR015424
10-229 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASETAK

HMMPfam: PF00266
IPR000192
15-228 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASETA

Gene3D: G3DSA:3.40.640.10
IPR015421
24-228 no description
Pyridoxal phosphate-dependent transferase, major r

PESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASETA

Seg: seg
60-74 seg

TTSGTPFIIPTTGTG

PatternScan: PS00595
IPR020578
195-215 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGMGIV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox