PRGDB00077195 (Stu.6042)

From PRG Wiki
Revision as of 17:56, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Stu.6042
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 46518271 (AB124833)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum StEIG-A51 mRNA for CC-NB-LRR protein, complete cds

DNA Sequence

CTTTCTAGCCATATACATGGATATTGCAGTTTCAACTTTGCAATGGTGTTGTGGTGATCCTTTGGCTTGGGCATGGGATGAGGTGAAAAAACAGTGTCTTTACTGTATAAAATATAAAGAAAATGCAGAAGCTTTTGAGAGTGATGCCACAGAATTCCTAGAAAAAGTTCAACGCCTCGAAGAGGCTGTCCAAAGAAGTGGACGACACAGCATCAGGGGAGAGCTTCAGAGACAGCTTGGTAAATCCACAGATGTCAAGAATAAGGTGAATGTTCTAACAAGCGATATGGAGACAGCAACAAGTACTGGTTGCATCTCTAACTATAAGCTTAGTAAAAGAATTGTTAAACTGAGAAAAGCTATGATGCAGCTGCTACAAGATCCAGAATTCATTTCAGCAGTATCTCTGCAACCACAAGCAATTAGGCCGCCCTCTCGTGTTAAACGGCCTGATGATTTTCTTTATTTCACCTCAAGAAAGCCAACCATGGATGAGATCATGAATGCCCTGAAAGATGAGGGGCGTAGCATTGTACGAGTATATGGGATGGGAGGTGTAGGTAAAACCTACATGGTAAAAGCATTGGCAAGTCGAGCTTTGAAGGaaaaaaaaTTTGATCGGGTGGTGGAATCAGTCGTCTCGCAAACTGTTGATTTGAGGAAAATTCAAGGGGACATTGCTCATGGCTTGGGGGTGGAACTTACCTCCACTGAAGTGCAAGATCGTGCGGATGACCTTAGGAACCTTTTCAATGACCATGGTAACATCCTGTTGATCTTGGATGGCTTGTGGGAGACAATAAACCTATCAACCATTGGGATACCACAATATTCCGAGCGCTGCAAATGCAAGATCTTAATCACTACAAGGCAGATGAATGTGTGTGACGATCTTGATAGGCAGTACTCCGCCATCCAAATCAATGTCCTTTCAGGCGATGATCCTTGGACATTGTTCACTCAAAAAGCTGGAGATAATCTGAAGGTGCCGCCTGGTTTTGAAGAGATAGGGAAGAAAATTGTTGAGGAATGCAGGGGATTACCAATAGCACTTTCGACTATTGGAAGTGCACTGTACAAGAAGGACTTGACATATTGGGAAACGGCAGCTACACGTCTCCATAGTTCCAAAACTGCATCCATCAAAGAAGATGATCTCAATTCTGTCATCAGAAAATGCATAGAACTGAGCTACAGTTTCTTGCCAAATGATACGTGCAAGCGGGTTTTCCTGATGTGCTCCATCTTTCCTGAAGATTATAATATCCCCAAGGAAACCTTGACAAGGTATGTCATGGGACTGGCCTTAATCCGAGGCATCGAGACAGTCAAAGAAGCAAGAGGTGATATTCATCAAATAGTCGAAGAACTCAAAGCTGCTTCCTTGCTCTTAGATGGCGATAAGGAGGAGACTGTCAAAATGCACGATGTTATACGTGATATTTCAATACAAATAGGATACAACCAGGAGAAACCCAAGAGCATTGTTAAAGCAAGCATGAAATTGGAGAACTGGCCAGGGGAAATCTTAACCAACTCATGTGGAGCAATCTCACTCATATCGAATCATCTTAAAAAGCTACCTGATAGAGTAGACTGCCCTGAAACTGAGATTCTATTGCTTCAGGATAACAAGAACTTAAGGCTAGTTCCAGATGAATTCTTCCAAGGTATGAGAGCTCTAAAAGTCTTGGATTTTACTGGTGTAAAATTCAAGTCCTTACCCTCCTCAACTCGGCAGTTGTCGCTTCTTCGCTTACTCTCTTTGGATAATTGCAGATTCCTAAAAGATGTATCTATGATAGGAGAACTTAACAGGCTTGAAATTTTGACTCTAAGAATGTCGGGGATCACATCATTGCCTGAAAGTTTTGCAAACTTGAAAGAGCTACGGATTCTAGATATTACATTATCTCTTCAATGTGAAAATGTTCCACCAGGAGTAATATCTAGCATGGATAAGTTAGAAGAGTTATACATGCAAGGCTGCTTTGCAGATTGGGAAATTACAAATGAAAACAGGAAAACTAACTTCCAAGAGATATTGACCTTGGGTAGCTTGACAATCTTGAAAGTAGATATCAAGAATGTTTGTTGCCTACCTCCTGATAGTGTTGCTCCTAATTGGGAGAAATTTGATATATGTGTGAGTGATTCAGAAGAATGCAGGTTGGCCAACGCAGCACAACAGGCCTCATTTACTAGAGGGTTAACCACTGGCGTGAATTTGGAAGCATTTCCAGAATGGTTTAGGCAGGCAGTATCACACAAAGCAGAGAAGCTGAGCTACCAATTTTGCGGGAATTTGAGCAATATTCTACAAGAATACCTCTATGGAAATTTTGATGAAGTGAAATCTCTTTATATAGACCAGTGTGCTGACATTGCCCAATTGATAAAGTTGGGAAATGGATTACCAAATCAGCCAGTGTTCCCTAAACTGGAGAAGCTGAATATTCACCACATGCAAAAAACGGAAGGTATCTGTACCGAGGAGTTACCACCTGGATCCTTACAACAAGTCAAGATGGTGGAGGTCTCAGAGTGTCCTAAACTGAAAGATTCACTCCTTCCTCCTAATTTAATTCAAAGAATGTCAAATCTTGAAGAGGTTAAGGTAACAGGAACCTCAATCAATGCTGTGTTTGGATTTGACGGCATCACATTCCAAGGTGGACAATTAAGGAAGTTGAAGAGATTGACACTGCTCAATCTTTCTCAACTAACTAGCCTATGGAAGGGTCCTAGTGAATTAGTTATGTTCCACAGGCTAGAAGTTGTTAAAGTGTCTCAACGTGAAAACCTCAGGTATATCTTCCCTTACACCGTTTGTGATTACCTTTGTCATTTACAAGTACTATGGCTAGAAGATTGCAGTGGTTTGGAGAAAGTGATAGGTGGTCACACAGATGAAAATGGAGTTCATGAAGTACCAGAAAGCATAACACTCCCAAGACTAACTACTTTGACGCTTCAACGTCTACCACATCTCACTGATTTCTACACTCAAGAGGCATATTTACGTTGCCCTGAATTGCAAAGACTGCATAAACAGGATTGCAAAAGATTGAGAACTAACCTCTCTGATTACCATAGTGATCAGGAAATCCAAGAAAAGAGCAGCTGAATCGTCAATTTTCATACtttttatatagttttgtttactgttttttacttttttatttttGGGTATATATAGCCCCCTTAAATTAAATTTAGTGTGCTTTAA


Protein sequences

Name Description Sequence
Stu.6042 translated coding region predicted by ESTScan from UniGene Stu.6042

XFLAIYMDIAVSTLQWCCGDPLAWAWDEVKKQCLYCIKYKENAEAFESDATEFLEKVQRLEEAVQRSGRHSIRGELQRQLGKSTDVKNKVNVLTSDMETATSTGCISNYKLSKRIVKLRKAMMQLLQDPEFISAVSLQPQAIRPPSRVKRPDDFLYFTSRKPTMDEIMNALKDEGRSIVRVYGMGGVGKTYMVKALASRALKEKKFDRVVESVVSQTVDLRKIQGDIAHGLGVELTSTEVQDRADDLRNLFNDHGNILLILDGLWETINLSTIGIPQYSERCKCKILITTRQMNVCDDLDRQYSAIQINVLSGDDPWTLFTQKAGDNLKVPPGFEEIGKKIVEECRGLPIALSTIGSALYKKDLTYWETAATRLHSSKTASIKEDDLNSVIRKCIELSYSFLPNDTCKRVFLMCSIFPEDYNIPKETLTRYVMGLALIRGIETVKEARGDIHQIVEELKAASLLLDGDKEETVKMHDVIRDISIQIGYNQEKPKSIVKASMKLENWPGEILTNSCGAISLISNHLKKLPDRVDCPETEILLLQDNKNLRLVPDEFFQGMRALKVLDFTGVKFKSLPSSTRQLSLLRLLSLDNCRFLKDVSMIGELNRLEILTLRMSGITSLPESFANLKELRILDITLSLQCENVPPGVISSMDKLEELYMQGCFADWEITNENRKTNFQEILTLGSLTILKVDIKNVCCLPPDSVAPNWEKFDICVSDSEECRLANAAQQASFTRGLTTGVNLEAFPEWFRQAVSHKAEKLSYQFCGNLSNILQEYLYGNFDEVKSLYIDQCADIAQLIKLGNGLPNQPVFPKLEKLNIHHMQKTEGICTEELPPGSLQQVKMVEVSECPKLKDSLLPPNLIQRMSNLEEVKVTGTSINAVFGFDGITFQGGQLRKLKRLTLLNLSQLTSLWKGPSELVMFHRLEVVKVSQRENLRYIFPYTVCDYLCHLQVLWLEDCSGLEKVIGGHTDENGVHEVPESITLPRLTTLTLQRLPHLTDFYTQEAYLRCPELQRLHKQDCKRLRTNLSDYHSDQEIQEKSS

Domains

Domain Start-End Description Sequence

Coil: coil
43-64 coiled-coil

AEAFESDATEFLEKVQRLEEAV

HMMPanther: PTHR23155
102-876 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

STGCISNYKLSKRIVKLRKAMMQLLQDPEFISAVSLQPQAIRPPSRVKRPDDFLYFTSRKPTMDEIMNALKDEGRSIVRVYGMGGVGKTYMVKALASRALKEKKFDRVVESVVSQTVDLRKIQGDIAHGLGVELTSTEVQDRADDLRNLFNDHGNILLILDGLWETINLSTIGIPQYSERCKCKILITTRQMNVCDDLDRQYSAIQINVLSGDDPWTLFTQKAGDNLKVPPGFEEIGKKIVEECRGLPIALSTIGSALYKKDLTYWETAATRLHSSKTASIKEDDLNSVIRKCIELSYSFLPNDTCKRVFLMCSIFPEDYNIPKETLTRYVMGLALIRGIETVKEARGDIHQIVEELKAASLLLDGDKEETVKMHDVIRDISIQIGYNQEKPKSIVKASMKLENWPGEILTNSCGAISLISNHLKKLPDRVDCPETEILLLQDNKNLRLVPDEFFQGMRALKVLDFTGVKFKSLPSSTRQLSLLRLLSLDNCRFLKDVSMIGELNRLEILTLRMSGITSLPESFANLKELRILDITLSLQCENVPPGVISSMDKLEELYMQGCFADWEITNENRKTNFQEILTLGSLTILKVDIKNVCCLPPDSVAPNWEKFDICVSDSEECRLANAAQQASFTRGLTTGVNLEAFPEWFRQAVSHKAEKLSYQFCGNLSNILQEYLYGNFDEVKSLYIDQCADIAQLIKLGNGLPNQPVFPKLEKLNIHHMQKTEGICTEELPPGSLQQVKMVEVSECPKLKDSLLPPNLIQRMSNLEEVKVTG

superfamily: SSF52540
137-382 P-loop containing nucleoside triphosphate hydrolases

LQPQAIRPPSRVKRPDDFLYFTSRKPTMDEIMNALKDEGRSIVRVYGMGGVGKTYMVKALASRALKEKKFDRVVESVVSQTVDLRKIQGDIAHGLGVELTSTEVQDRADDLRNLFNDHGNILLILDGLWETINLSTIGIPQYSERCKCKILITTRQMNVCDDLDRQYSAIQINVLSGDDPWTLFTQKAGDNLKVPPGFEEIGKKIVEECRGLPIALSTIGSALYKKDLTYWETAATRLHSSKTASI

Gene3D: G3DSA:3.40.50.300
160-303 no description

RKPTMDEIMNALKDEGRSIVRVYGMGGVGKTYMVKALASRALKEKKFDRVVESVVSQTVDLRKIQGDIAHGLGVELTSTEVQDRADDLRNLFNDHGNILLILDGLWETINLSTIGIPQYSERCKCKILITTRQMNVCDDLDRQY

HMMPfam: PF00931
IPR002182
162-434 NB-ARC,NBS
NB-ARC

PTMDEIMNALKDEGRSIVRVYGMGGVGKTYMVKALASRALKEKKFDRVVESVVSQTVDLRKIQGDIAHGLGVELTSTEVQDRADDLRNLFNDHGNILLILDGLWETINLSTIGIPQYSERCKCKILITTRQMNVCDDLDRQYSAIQINVLSGDDPWTLFTQKAGDNLKVPPGFEEIGKKIVEECRGLPIALSTIGSALYKKDLTYWETAATRLHSSKTASIKEDDLNSVIRKCIELSYSFLPNDTCKRVFLMCSIFPEDYNIPKETLTRYVMG

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

IVRVYGMGGVGKTYMV

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

FNDHGNILLILDGLW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CRGLPIALSTIGSAL

superfamily: SSF52058
474-1024 L domain-like,LRR

KMHDVIRDISIQIGYNQEKPKSIVKASMKLENWPGEILTNSCGAISLISNHLKKLPDRVDCPETEILLLQDNKNLRLVPDEFFQGMRALKVLDFTGVKFKSLPSSTRQLSLLRLLSLDNCRFLKDVSMIGELNRLEILTLRMSGITSLPESFANLKELRILDITLSLQCENVPPGVISSMDKLEELYMQGCFADWEITNENRKTNFQEILTLGSLTILKVDIKNVCCLPPDSVAPNWEKFDICVSDSEECRLANAAQQASFTRGLTTGVNLEAFPEWFRQAVSHKAEKLSYQFCGNLSNILQEYLYGNFDEVKSLYIDQCADIAQLIKLGNGLPNQPVFPKLEKLNIHHMQKTEGICTEELPPGSLQQVKMVEVSECPKLKDSLLPPNLIQRMSNLEEVKVTGTSINAVFGFDGITFQGGQLRKLKRLTLLNLSQLTSLWKGPSELVMFHRLEVVKVSQRENLRYIFPYTVCDYLCHLQVLWLEDCSGLEKVIGGHTDENGVHEVPESITLPRLTTLTLQRLPHLTDFYTQEAYLRCPELQRLHKQDCKRL

Gene3D: G3DSA:3.80.10.10
518-668 no description

ISLISNHLKKLPDRVDCPETEILLLQDNKNLRLVPDEFFQGMRALKVLDFTGVKFKSLPSSTRQLSLLRLLSLDNCRFLKDVSMIGELNRLEILTLRMSGITSLPESFANLKELRILDITLSLQCENVPPGVISSMDKLEELYMQGCFADW

HMMPfam: PF13855
538-594 LRR_8,Leucine rich repeat

EILLLQDNKNLRLVPDEFFQGMRALKVLDFTGVKFKSLPSSTRQLSLLRLLSLDNCR

Seg: seg
574-590 seg

SLPSSTRQLSLLRLLSL

FPrintScan: PR00364
IPR000767
580-596 DISEASERSIST
Disease resistance protein

RQLSLLRLLSLDNCRFL

Gene3D: G3DSA:3.80.10.10
758-1022 no description

KAEKLSYQFCGNLSNILQEYLYGNFDEVKSLYIDQCADIAQLIKLGNGLPNQPVFPKLEKLNIHHMQKTEGICTEELPPGSLQQVKMVEVSECPKLKDSLLPPNLIQRMSNLEEVKVTGTSINAVFGFDGITFQGGQLRKLKRLTLLNLSQLTSLWKGPSELVMFHRLEVVKVSQRENLRYIFPYTVCDYLCHLQVLWLEDCSGLEKVIGGHTDENGVHEVPESITLPRLTTLTLQRLPHLTDFYTQEAYLRCPELQRLHKQDCK

Seg: seg
894-912 seg

QLRKLKRLTLLNLSQLTSL

Seg: seg
983-999 seg

TLPRLTTLTLQRLPHLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox