PRGDB00077252 (Stu.11942)

From PRG Wiki
Revision as of 17:57, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Stu.11942
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21377774 (BQ518905)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

EST626320 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMJM81 5' end, mRNA sequence

DNA Sequence

GAGCCCACAAAACTTCTTTTCCATTCTTTCTAAGAGGGAAACTATAGAGTTAACACAATCATATAGCAATTATTAATCTCTCTATTTGCACTCTAAGTTTTACATGGAGAAGATCGAGTTAACTACTTCTCGATGCTATTTTTCATCGAATGATGAGGAATTTGTGGGGTTTAAGGAGGATGTAGAACAGATCATTCAGAAATTGACTAAAGGAACAAAAGAACGCAAAGTTATATCGATTGTTGGAATGGCAGGACTAGGCAAAACAACTTTGGCTAGAAAGGTGTACAACAATCATTCTGTTGCTGATCACTTTGACGTTCACGCATTTTGTATTGTTTCACAAACATATAGCATCAGGAAGCTATTGTTTGAGATTCTTAAACAAGCCACGGGTGAAAAACGTGACATGATCAAAGAGGATGAGGACGTTGCAGATACGTTGAGGAAGGCACTTTATGGTAAGAGATACCTCATTGTTTTAGATGATATGTGGAACTATGAGGCATGGGAAGATTTGCAATCATGTTTCCCTTGTGTGGGAAAGAGTAGTAGAATTATGGTAACAACTCGCATTCAAGAGGTGCTATTAAGATGAGTGATCCTCATTTTCTTGGATCCT


Protein sequences

Name Description Sequence
Stu.11942 translated coding region predicted by ESTScan from UniGene Stu.11942

MEKIELTTSRCYFSSNDEEFVGFKEDVEQIIQKLTKGTKERKVISIVGMAGLGKTTLARKVYNNHSVADHFDVHAFCIVSQTYSIRKLLFEILKQATGEKRDMIKEDEDVADTLRKALYGKRYLIVLDDMWNYEAWEDLQSCFPCVGKSSRIMVTTRIQEVLLRXVILIFLDP

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
3-164 P-loop containing nucleoside triphosphate hydrolases

KIELTTSRCYFSSNDEEFVGFKEDVEQIIQKLTKGTKERKVISIVGMAGLGKTTLARKVYNNHSVADHFDVHAFCIVSQTYSIRKLLFEILKQATGEKRDMIKEDEDVADTLRKALYGKRYLIVLDDMWNYEAWEDLQSCFPCVGKSSRIMVTTRIQEVLLR

HMMPanther: PTHR23155:SF121
14-153 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SSNDEEFVGFKEDVEQIIQKLTKGTKERKVISIVGMAGLGKTTLARKVYNNHSVADHFDVHAFCIVSQTYSIRKLLFEILKQATGEKRDMIKEDEDVADTLRKALYGKRYLIVLDDMWNYEAWEDLQSCFPCVGKSSRIM

HMMPanther: PTHR23155
14-153 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SSNDEEFVGFKEDVEQIIQKLTKGTKERKVISIVGMAGLGKTTLARKVYNNHSVADHFDVHAFCIVSQTYSIRKLLFEILKQATGEKRDMIKEDEDVADTLRKALYGKRYLIVLDDMWNYEAWEDLQSCFPCVGKSSRIM

Gene3D: G3DSA:3.40.50.300
18-137 no description

EEFVGFKEDVEQIIQKLTKGTKERKVISIVGMAGLGKTTLARKVYNNHSVADHFDVHAFCIVSQTYSIRKLLFEILKQATGEKRDMIKEDEDVADTLRKALYGKRYLIVLDDMWNYEAWE

HMMPfam: PF00931
IPR002182
24-163 NB-ARC,NBS
NB-ARC

KEDVEQIIQKLTKGTKERKVISIVGMAGLGKTTLARKVYNNHSVADHFDVHAFCIVSQTYSIRKLLFEILKQATGEKRDMIKEDEDVADTLRKALYGKRYLIVLDDMWNYEAWEDLQSCFPCVGKSSRIMVTTRIQEVLL

FPrintScan: PR00364
IPR000767
43-58 DISEASERSIST
Disease resistance protein

VISIVGMAGLGKTTLA

FPrintScan: PR00364
IPR000767
117-131 DISEASERSIST
Disease resistance protein

ALYGKRYLIVLDDMW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox