PRGDB00077259 (Stu.12247)

From PRG Wiki
Revision as of 17:57, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Stu.12247
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 17073171 (BM110993)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

EST558529 potato roots Solanum tuberosum cDNA clone cPRO9L18 5' end, mRNA sequence

DNA Sequence

GACTTGTGGAAAGGAAACTGCTCTTTCTTCTGGAGAGCCTTCCAACAAACGCAGCATTCCATCAATTGATGATGATGAAGTTGTCGGCTTTGAGAATGATGCAGAAATTATAATGAAGAAATTGACTGGAAGAACAAAGGAGTTGGATGTCCTCTCAATCTTTGGAATGCCAGGACTCGGAAAAACAACTCTGGCCAGGAAAGTGTACAACAATCCTTCTATTGTTAATCACTTTGATGTTAAAGCATGGTGTGCTGTGTCTCAAGCATATAATAGGACGACGTTGTTGGTTGAGATTTTCAAACAAGCTATAAATAAAGAGTGCAAAATCAAGGAGAATGATAACGTAGCTGACATGTTGCGCAAGATTCTAATAGGCAAGAGATACCTCATCGTGTTAGATGATATATGGGACGTCGAGGCATGGGAGGATTTGAGATTATGTTTCCCTAGAGGTGAAAACGGATGCAGAGTAATGGTAACAACTAGAATTGAACAAGTTGCTAAGCATCTCCAGCACTGTAGTGATCCTTATTATCTTTAGATTTCTACATGGAAGAGAGTTGGGTATTATTGCAGAAGAAAGTGTTTCG


Protein sequences

Name Description Sequence
Stu.12247 translated coding region predicted by ESTScan from UniGene Stu.12247

XTCGKETALSSGEPSNKRSIPSIDDDEVVGFENDAEIIMKKLTGRTKELDVLSIFGMPGLGKTTLARKVYNNPSIVNHFDVKAWCAVSQAYNRTTLLVEIFKQAINKECKIKENDNVADMLRKILIGKRYLIVLDDIWDVEAWEDLRLCFPRGENGCRVMVTTRIEQVAKHLQHCSDPYYL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
7-172 P-loop containing nucleoside triphosphate hydrolases

TALSSGEPSNKRSIPSIDDDEVVGFENDAEIIMKKLTGRTKELDVLSIFGMPGLGKTTLARKVYNNPSIVNHFDVKAWCAVSQAYNRTTLLVEIFKQAINKECKIKENDNVADMLRKILIGKRYLIVLDDIWDVEAWEDLRLCFPRGENGCRVMVTTRIEQVAKHL

HMMPanther: PTHR23155:SF121
18-152 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RSIPSIDDDEVVGFENDAEIIMKKLTGRTKELDVLSIFGMPGLGKTTLARKVYNNPSIVNHFDVKAWCAVSQAYNRTTLLVEIFKQAINKECKIKENDNVADMLRKILIGKRYLIVLDDIWDVEAWEDLRLCFPR

HMMPanther: PTHR23155
18-152 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RSIPSIDDDEVVGFENDAEIIMKKLTGRTKELDVLSIFGMPGLGKTTLARKVYNNPSIVNHFDVKAWCAVSQAYNRTTLLVEIFKQAINKECKIKENDNVADMLRKILIGKRYLIVLDDIWDVEAWEDLRLCFPR

Gene3D: G3DSA:3.40.50.300
22-146 no description

SIDDDEVVGFENDAEIIMKKLTGRTKELDVLSIFGMPGLGKTTLARKVYNNPSIVNHFDVKAWCAVSQAYNRTTLLVEIFKQAINKECKIKENDNVADMLRKILIGKRYLIVLDDIWDVEAWEDL

HMMPfam: PF00931
IPR002182
32-178 NB-ARC,NBS
NB-ARC

ENDAEIIMKKLTGRTKELDVLSIFGMPGLGKTTLARKVYNNPSIVNHFDVKAWCAVSQAYNRTTLLVEIFKQAINKECKIKENDNVADMLRKILIGKRYLIVLDDIWDVEAWEDLRLCFPRGENGCRVMVTTRIEQVAKHLQHCSDP

FPrintScan: PR00364
IPR000767
51-66 DISEASERSIST
Disease resistance protein

VLSIFGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
124-138 DISEASERSIST
Disease resistance protein

ILIGKRYLIVLDDIW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox