PRGDB00077446 (Ta.568)

From PRG Wiki
Revision as of 18:03, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ta.568
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241985824 (AK333085)
Gene Class Unknown
Domain Type
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT005_J18, cultivar: Chinese Spring

DNA Sequence

GACGTATTACCGCGGCTCCTCCCCTGGTCACCGGCGAGAAAAAGCAAGATGGACTACATGAATGGGCCAGGCCGGAACCACCTGTTCGTCCCTGGGCCGGTGAACATCCCGGACCAGGTGATCCGCGCCATGAGCCGGCAGAACGAGGACTACCGCTCGCCGGCGATCCCTGCCCTCACCAAGACCCTGCTGGAGGACGTGAAGAAGATCTTCAAGACCACCACCGGCACCCCCTTCCTCTTCCCCACCACCGGCACCGGCGCCTGGGAGAGCGCGCTCACCAACACGCTCTCCCCGGGGGACCGGATCGTGTCCTTCTCGCTGGGGCAGTTCAGCCTGCTGTGGATCGACCAGCAGCAGCGCCTCGGCTTCAGCGTGGACGTGGTGGAGTCCGACTGGGGCTACGGCGCCGACCTCGGCGCCCTCGAGTCCAAGCTCCGCACTGACTCGCAGCACACCATCAAGGCCATCTGCATCGTCCACAACGAGACCGCCACCGGCGTCACCAACGACCTCCACGCCGTCCGCAAGCTCCTCGATGCGTACCGGCACCCGGCGCTGCTGCTGGTGGACGGGGTGTCGTCCATCTGCGCGCTGGACTTCCGCATGGACGAGTGGGGCGTGGACGTGGCGCTGACGGGGTCGCAGAAGGCGCTGTCGCTGCCGACGGGGCTGGGCATCGTGTGCGCCAGCCCCAAGGCGCTGGAGGCGGCCAAGACGGCCAAGTCGGTGCGCGTCTTCTTCGACTGGAAGGACTACCTCAAGTTCTACAAGATGGGCACCTACTGGCCCTACACGCCCTCCATCCAGCTCCTCTACGGCCTCCGCGCCGGCCTCGACCTCCTCTTCGAGGAGGGCCTCGACAACGTCATCAAGAGGCACACACGCCTCGGCACCGCAACAAGGCTGGCGGTGGCGGCGTGGGGGCTCAAGAACTGCACCGCGAAGGAGGAGAACTTCAGCGACACGGTCACCGCCGTCGTCGTGCCGCCGTACATCGACAGCTCCGAGATCGTCAAGCACGCGTGGAAGCGGTACAACCTCAGCCTCGGGCTCGGGCTCAACAAGGTCGCCGGCAAGGTCTTCAGGATCGGCCACCTCGGCCACCTCAACGAGCTGCAACTTCTGGGTTGCCTCGGCGGGGTGGAGATGGTGCTCAAGGACATCGGGTACCCGGTGAAGCTCGGCAGCGGCGTGGCGGCCGCCGCGGCGTACCTCTCGAATTCCACGCCCCTCATCCCCTCCAGGATCTGAGCAAATCCCACGCACGAAAGCAAGGGGGTCGCGAGAAGAAGAACAAACATCATGCAGTGCCCTGCTTCGGGAGCAGAGCAGGCGTAGTACACTACTGGTTCTGGTTATACTCTCTGTATGTAAAGTTAATTTTCACACACCCATCTGTGCTAAAGGAGTATAATTTCGTCaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.568 translated coding region predicted by ESTScan from UniGene Ta.568

DVLPRLLPWSPARKSKMDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
15-417 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SKMDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI

HMMPanther: PTHR21152
15-417 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

SKMDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI

superfamily: SSF53383
IPR015424
23-393 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPV

HMMPfam: PF00266
IPR000192
28-347 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYN

Gene3D: G3DSA:3.40.640.10
IPR015421
37-273 no description
Pyridoxal phosphate-dependent transferase, major r

PDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYGADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLY

Seg: seg
73-87 seg

TTTGTPFLFPTTGTG

PatternScan: PS00595
IPR020578
208-228 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Seg: seg
271-282 seg

LLYGLRAGLDLL

Gene3D: G3DSA:3.90.1150.10
IPR015422
274-399 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox