PRGDB00077696 (Ta.33544)

From PRG Wiki
Revision as of 18:10, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ta.33544
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241986650 (AK333911)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT008_J23, cultivar: Chinese Spring

DNA Sequence

GGAGCTGGACGAGGAAGACGAAGGCGAGGCTTAAGCCTAAACCCCATCCCCGTCCTCCTCCTCCGGTCGCCGCCGCGGGATGGAGATCAAGGGGCTGGGCCAGCTCCTGGCGGCGCTGGCCGCGGCGCTGTTCCTGCGGGTCGTCGCCGCGGGGGCCGGCCCCGCCCTCCTCCCGCCCGCGGAGGACGACGAGGGCGAGGACCTGGAGGCCGGCGAGGGCGGCGGGGTGCGGCCCGTGACCATCCGGTGGGCCCGCGTCACCTGCGCCCTCAAGAACAAGCGCGGGGACGTGGCAAGGTTCCTGCTGTCGAATCTGTCCGGGGAGGCGAAACCAGGGAGGCTGCTGGCACTCATGGGGCCGTCAGGGTCCGGCAAGACGGCTCTGCTCAATGTGCTGGCAGGGCAGCTCGCGGCGTCGCCTTCCTTGCACCTCTCTGGGTTTCTCTACGTCAATGGCCAGCCCATGTCGCAGGGCGGTTATAAGATTGCTTATGTGAGGCAAGAAGACATTTTCTTCTCACAGCTCACGGTGCGGGAAACGCTCTCCCTTGCTGCTGAGCTCCAGCTTCCTGACACCATGTCTCCTGAGAGGAAGGAGAAGTATGTTAATGATCTCTTGTTTCGTCTTGGATTGGTCAACTCTGCTGATTCTATTGTGGGTGATGCAAAAGTACGTGGAATTAGTGGTGGTGAAAAGAAGCGCCTCTCGCTTGCATGTGAACTTATTGCAAGTCCTTCAGTCATCTTTGCGGATGAACCAACAACAGGTCTTGATGCATTCCAGGCAGAGAAGGTGATGGAGACTCTTAGACAGCTTGCAGAAGATGGGCACACTGTCATATGCTCTATACACCAGCCGAGAGGTTCAGTCTATAGCAAATTTGATGACATTGTGCTACTCTCAGAGGGAGAAGTTGTATATATGGGGCCGGCAAAAGAAGAACCTCTAAAATACTTTGCATCATTAGGGTACCAATGCCCAGATCATGAGAACCCTGCTGAGTTCTTGGCTGATCTCATTTCCACTGATTATAGCTCAGCTGAAAGTGTGCAGTCATCACAGAAAAGGATTGAGAACCTAATTGATGATTTTGCGAATAAGGTTCTGATTACTGAATTTAACAGTCCAGTAACACAATCGGAGGGCTCTGAATTTTCTACCAAACTTGCTCAGAAGTCCACTAGCAAGCAAAGACGTGGTTGGTGGAGACAATTCCATTTGCTGTTCAAGAGAGCATGGATGCAGGCTTTTCGTGATGGACCAACAAACAAAGTGAGAGCAAGAATGTCTGTTGCTTCAGCAATTATATTTGGATCAGTGTTCTGGCGAATGGGGAAAACTCAAACTTCCATACAAGATAGGATGGGACTTCTTCAGGTGGCTGCCATAAACACAGCAATGGCTGCTCTGACAAAGACGGTGGGGGTTTTCCCGAAAGAACGAGCTATAATTGACAGAGAACGAGCAAAAGGTTCCTATGCACTTGGACCATATCTCTCATCTAAGCTGCTGGCCGAGATTCCGATTGGAGCAGCATTTCCGTTGATGTTTGGATCCATTCTCTATCCAATGGCTAAACTTCATCCAACAATTTCGAGATTTGCCAAGTTCTGTGGCATTGTGACTGTTGAATCGTTTGCGGCATCAGCCATGGGTCTTACTGTGGGAGCAATCGCTCCTACAACCGAGGCTGCGATGGCTCTTGGGCCATCCCTTATGACGGTGTTCATCGTCTTTGGAGGATACTATGTGAACCCTGATAACACCCCCGTCATCTTCCGCTGGATCCCGAAAGCGTCTCTGATCAGATGGGCCTTTCAAGGACTTTGCATCAACGAGTTCAAGGGTCTGCAGTTTGAGCACCAACATTCTTATGATGTTCAAACTGGAGAACAGGCCCTGGAGAGATTTTCACTGGGAGGAATCCGCATCGCCGACACACTGGTGGCGCAGGGCAGGATCCTGATGTTCTGGTACTGGATGACCTACCTCCTCCTGAAGAAAAACAGAGCGAGGTACCAGCAGCTCCTGCCGCCCTCCGAGGAAGATCAAAGTAAGCAGCAGACGGAGTAGGCGTAATCATAATTTGCAACATATTTATTCTGTGAAGAGATCATGGCAGGTAGTGCAGGCCGTGTGTTGTAGCCAGtttttttttCTGCTTCTGTGACATTTTTAGCATCCCTCTTTGGAAGAATCAAGAGAAATAAAATCGTGGGAGAACCATCaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.33544 translated coding region predicted by ESTScan from UniGene Ta.33544

GAGRGRRRRGLSLNPIPVLLLRSPPRDGDQGAGPAPGGAGRGAVPAGRRRGGRPRPPPARGGRRGRGPGGRRGRRGAARDHPVGPRHLRPQEQARGRGKVPAVESVRGGETREAAGTHGAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGEVVYMGPAKEEPLKYFASLGYQCPDHENPAEFLADLISTDYSSAESVQSSQKRIENLIDDFANKVLITEFNSPVTQSEGSEFSTKLAQKSTSKQRRGWWRQFHLLFKRAWMQAFRDGPTNKVRARMSVASAIIFGSVFWRMGKTQTSIQDRMGLLQVAAINTAMAALTKTVGVFPKERAIIDRERAKGSYALGPYLSSKLLAEIPIGAAFPLMFGSILYPMAKLHPTISRFAKFCGIVTVESFAASAMGLTVGAIAPTTEAAMALGPSLMTVFIVFGGYYVNPDNTPVIFRWIPKASLIRWAFQGLCINEFKGLQFEHQHSYDVQTGEQALERFSLGGIRIADXTGGAGQDPDVLVLDDLPPPEEKQSEVPAAPAALRGRSK

Domains

Domain Start-End Description Sequence

Seg: seg
3-10 seg

GRGRRRRG

Seg: seg
31-79 seg

GAGPAPGGAGRGAVPAGRRRGGRPRPPPARGGRRGRGPGGRRGRRGAAR

ProfileScan: PS50893
IPR003439
88-327 ABC_TRANSPORTER_2
ABC transporter-like

LRPQEQARGRGKVPAVESVRGGETREAAGTHGAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGEVVYMGPAKEEPLKYFASLGYQCP

HMMSmart: SM00382
IPR003593
111-304 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

TREAAGTHGAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGE

Gene3D: G3DSA:3.40.50.300
118-338 no description

HGAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGEVVYMGPAKEEPLKYFASLGYQCPDHENPAEFLAD

HMMPanther: PTHR19241:SF28
119-646 ABC TRANSPORTER (PLANT),ABC TRANSPORTER (PLANT)

GAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGEVVYMGPAKEEPLKYFASLGYQCPDHENPAEFLADLISTDYSSAESVQSSQKRIENLIDDFANKVLITEFNSPVTQSEGSEFSTKLAQKSTSKQRRGWWRQFHLLFKRAWMQAFRDGPTNKVRARMSVASAIIFGSVFWRMGKTQTSIQDRMGLLQVAAINTAMAALTKTVGVFPKERAIIDRERAKGSYALGPYLSSKLLAEIPIGAAFPLMFGSILYPMAKLHPTISRFAKFCGIVTVESFAASAMGLTVGAIAPTTEAAMALGPSLMTVFIVFGGYYVNPDNTPVIFRWIPKASLIRWAFQGLCINEFKGLQFEHQHSYDVQTGEQALERFSLGGIRIAD

HMMPanther: PTHR19241
119-646 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGEVVYMGPAKEEPLKYFASLGYQCPDHENPAEFLADLISTDYSSAESVQSSQKRIENLIDDFANKVLITEFNSPVTQSEGSEFSTKLAQKSTSKQRRGWWRQFHLLFKRAWMQAFRDGPTNKVRARMSVASAIIFGSVFWRMGKTQTSIQDRMGLLQVAAINTAMAALTKTVGVFPKERAIIDRERAKGSYALGPYLSSKLLAEIPIGAAFPLMFGSILYPMAKLHPTISRFAKFCGIVTVESFAASAMGLTVGAIAPTTEAAMALGPSLMTVFIVFGGYYVNPDNTPVIFRWIPKASLIRWAFQGLCINEFKGLQFEHQHSYDVQTGEQALERFSLGGIRIAD

superfamily: SSF52540
119-313 P-loop containing nucleoside triphosphate hydrolases

GAVGSGKTALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLRQLAEDGHTVICSIHQPRGSVYSKFDDIVLLSEGEVVYMGPAKE

HMMPfam: PF00005
IPR003439
127-255 ABC_tran
ABC transporter-like

ALLNVLAGQLAASPSLHLSGFLYVNGQPMSQGGYKIAYVRQEDIFFSQLTVRETLSLAAELQLPDTMSPERKEKYVNDLLFRLGLVNSADSIVGDAKVRGISGGEKKRLSLACELIASPSVIFADEPTT

PatternScan: PS00211
IPR017871
227-241 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGEKKRLSLACEL

HMMPfam: PF01061
IPR013525
403-614 ABC2_membrane
ABC-2 type transporter

RQFHLLFKRAWMQAFRDGPTNKVRARMSVASAIIFGSVFWRMGKTQTSIQDRMGLLQVAAINTAMAALTKTVGVFPKERAIIDRERAKGSYALGPYLSSKLLAEIPIGAAFPLMFGSILYPMAKLHPTISRFAKFCGIVTVESFAASAMGLTVGAIAPTTEAAMALGPSLMTVFIVFGGYYVNPDNTPVIFRWIPKASLIRWAFQGLCINEF

Seg: seg
654-666 seg

DPDVLVLDDLPPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox