PRGDB00077740 (Ta.37361)

From PRG Wiki
Revision as of 18:11, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ta.37361
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241987348 (AK334605)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT010_G23, cultivar: Chinese Spring

DNA Sequence

GGGATAGCGATGTGAGGCTACTGTTTTGCCCACAACTGGGGAGCGGAGCGGGGATGGAACTGGAAGGCTACGTCTTCATTGCCGGCGAGGGCTAGGATCTTCGTCTCCGCCCAAGCTCACCCCCCGTTCCATCCCTCCCACACCCGGCGGCGCGCGCGGCGACGGTGCCCCTCGCTCGCCGTGGACTGCCGGCGGCGGCGACGATTGGCCATTCTAATGATATTTAGGAAGGTCACCACCAAAGGCATTAGCAATTTTCAGAAATAATGGCAGAGATTGTAATTCTTCTAGCCATTAAAAAGATCGGAATCGCCTTGGCAAGTAGAGTGGCAAACCAGGCCAACGTGCAGTTTGGAAAGTACAAAACACAACTACAAGAGCTACATGGCAGTATGGGTCGTGTTGCGAGGGAGCTTCGCATAATGCATGAAGTGCTCTGTCACATGGATATTCGGAACCGCAACAATCAAGTTTATGACGGCTGGTTGGAGGAGGTACAGAAAGTAGCACATGTGATGGAGGACATGGTGGATGAGTACTTATATCTAGTTGGTCGGGAACATGATATTGGGTCTTGTTTTTACCTGAAAAAGGGCTTCAGAAAATCCAGATCTCTGCTTTCTATGAACCAGTTAGCTTTCAAGGTGAAGGAAATAGAGAAAGACCTTAGTCACCTATCAGAGACAAACAAACGTTGGGTTCCCATGACAATCAGCGGGGCCACGAGCAGCTGTGATTACATTGTCAAGAGGGGCCAAGATCTAGCAAATATTTCACGTTCCCTTGATGAAGAAGATCTTGTGGGGTTGGCTGAAAACAGAGAAAAACTTGAGCAGTGGTTGGCAGATGATGATTTGGAATGCTCGGTCATAGCGCTGCTTGGAATGGGAGGGCTTGGTAAAACAACTTTAGCTGCAAATGTCTACAGGAATGAGAGAAAGAAATTCCAATGCCATGCCTGGGTCTCCATCTCTCAAACTTATTCTAGAGAAGATGTCTTGAGGAATATATGCAAGGAACTTTTCAAAGATAATGTCAGTGTTCTATCTAAATCTGCAGCTATGGACATCACATGCCTTGAGGAGACACTGAAGAGTTTTCTGGAGCAACGAAAGTACTTGATCATATTGGACGATGTTTGGACTCCAGAAACATTTGATGATTTGTCTAGGATGGTTATTCATAATGATAAGGGAAGTAGACTGATAATCACAACCAGGGAAGGCGATGTTGCTGCACTTGCCTCTCCAGGACATATCTTAACACTAGAAGCTTTACGAGAAGATAAGGCATGGGATCTCTTTTGTAAAAAAACATTTCCAAAAGAAACAAATCATGATTGTCATGCGGAGTTAAAGCCTTTGTCCAGGGAAATAGTTAGCAGGTGTAAAGGCTTGCCTCTTGCTATTGTGTCAGTTGCTAGCCTCTTGCGTGTGCGTGAGAAAACTGTGGAAGAATGGAGAAGAATAAATAACCAACTGAGCTGGGAGATAATTAATAATTCGAGGCTCGACCACATAAGGAATGTTTTGCATCTGAGTTTCATCTACCTTCCAACGCACTTGAAAAGTTGTTTTTTGTACTGCAGCTTATTTCCAGAAGACTATCTTCTCAAAAGGAAACAACTTGTAAGGTTATGGATAGCAGAGGGGTTCATCGAGGGGAGGGGTGAAAGCACATTAGAAGAAGTAGCAGAAGGCTATCTGAAGCAGTTGGTTGATAGAAACATGCTACAACTTGTCGAGATGAACTCATTTGGCAGGATAAAAGAATTCAAAATGCATGATATATTACGTGAACTGGCAGTTGATTTGTGCCAGAAGAACTGTTTTGGTGTTTCACAAGAGGCTAAATGTGAGGCGTCTCTTGAGATGGATGGACGCCGATTGATACTTGACAAAATAAACAATGATGTTCAACAGTCATTTTCTGGTTTACAGCAACTTCGAAGTGCGATTACAGCAGGCGATAGTAAGTCACCATTCACTCTACTACCTCTGCTATGTAAGGAGTCAAGATATATGACAGTGCTAGAATTAAGTGGTATACCCATCAAGAAGATTCCAGATGCTATTGGAGATCTTTTTAATCTCCGCCATTTGGGTTTGCGTAATTCAAAGGTGAAAATGCTCCCAAGGTCTGTTGAGAAGCTTTCAAATTTGTTGACACTAGACCTTTGTAAATCTGACATACATGAGTTGCCTAGTGGGATTGTGAAACTTAAGAAGCTCAGGCACTTATTTGTTGAGAAAATAATGGGTCCAGATTGGAGAAACATCAATCATCTCAGTGGTATGTGTATCCCCAATGGACTCGGGAATCTAACAAACCTGCAAACACTACAAGCATTGCAAGTACAGGATGAGTCCCTTAGACATCTAGGGGAGCTGAGGCAACTGAAAAGCTTGAGGTTATTGAATGTGAAGGGAATCTACTGCGGACGCATCAGTGAATCTCTAGTTCAAATGCGGCATTTGTCCTTGCTATCTGTGAATGCAAGTGATGGGAATGAGGTTCTCTTGTTGAATGTTCTCCTGCCAAGCCTACAAAAGCTAAGATTGAGAGGACGGCTAGCGGAAGGTGCATTGGATGAGTCTCCTCTCTTCCAAGCTGTCGGAGGGCAGAATTTGTATGAATTAGTCCTATCTTGGTCACAGCTGACAAAAGACCCCTTGCCGTCCCTTTCTCGGTTGTCAAGCTTGACGCGTCTACATTTCACTAGAGCATACACCGGAGAGCATTTGTCATTTCTCACGGGGTGGTTTCCCAAGCTAAAGGTTCTCTCTCTGACAGACCTCCCTAATTTGAAACGTCTAGAGATACAGCAAGGTGCCATGGGGTCCCTGGAACATTTATTCCTAATCAGACTCAGCAGCATGACCGAGGTCCCACCTGGCATTGAGTTCGTCATGCCTCTCGAGTATCTAGGCTTCCACGAAATCACCGGCGACTTCTTGTATTTGCTGCGCCATTGTTCTGCGATTCAAGGGACGCGGTTGAGGTACTCTCTGCGAGATTGAGCTACCACTGCTCTGGAAATGTGTGGGTGTCGTCGGCCGGAAGGAAGATGCTTCCACTTTTCGGTTTCCTCTGTTTCTTTAAGATGGACTACTGCACTTTTTGCTGTTAGTTCCACTTCTACTTATCGTGCTTCACTTCTGCTGCAACTGCCTGCATTTGGTAATGCTAGTGTTGATTGTGTGCTCGGTTGTAGGGTGTGACAATGTTGCCTACTGCTCAATTCCGACTGTGATTGTTAAGACTGCGAGTGAGTTGTGTTTCCATATTCAGACTAGCGCAGCGCTTGCTGCCAGTCCCACATCCTGCTGTTGTTCGTGTGCTTGTTGTCAAGTATGATAATATTTCCTGTTAGTTATTTTCCCTTGTGGCTTACAAATAAGGCGACACTTACTGTAAGGCTGAGACCGAGTGTTATTTTCATATTCAGACTAATTGCATTTCCaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.37361 translated coding region predicted by ESTScan from UniGene Ta.37361

MAEIVILLAIKKIGIALASRVANQANVQFGKYKTQLQELHGSMGRVARELRIMHEVLCHMDIRNRNNQVYDGWLEEVQKVAHVMEDMVDEYLYLVGREHDIGSCFYLKKGFRKSRSLLSMNQLAFKVKEIEKDLSHLSETNKRWVPMTISGATSSCDYIVKRGQDLANISRSLDEEDLVGLAENREKLEQWLADDDLECSVIALLGMGGLGKTTLAANVYRNERKKFQCHAWVSISQTYSREDVLRNICKELFKDNVSVLSKSAAMDITCLEETLKSFLEQRKYLIILDDVWTPETFDDLSRMVIHNDKGSRLIITTREGDVAALASPGHILTLEALREDKAWDLFCKKTFPKETNHDCHAELKPLSREIVSRCKGLPLAIVSVASLLRVREKTVEEWRRINNQLSWEIINNSRLDHIRNVLHLSFIYLPTHLKSCFLYCSLFPEDYLLKRKQLVRLWIAEGFIEGRGESTLEEVAEGYLKQLVDRNMLQLVEMNSFGRIKEFKMHDILRELAVDLCQKNCFGVSQEAKCEASLEMDGRRLILDKINNDVQQSFSGLQQLRSAITAGDSKSPFTLLPLLCKESRYMTVLELSGIPIKKIPDAIGDLFNLRHLGLRNSKVKMLPRSVEKLSNLLTLDLCKSDIHELPSGIVKLKKLRHLFVEKIMGPDWRNINHLSGMCIPNGLGNLTNLQTLQALQVQDESLRHLGELRQLKSLRLLNVKGIYCGRISESLVQMRHLSLLSVNASDGNEVLLLNVLLPSLQKLRLRGRLAEGALDESPLFQAVGGQNLYELVLSWSQLTKDPLPSLSRLSSLTRLHFTRAYTGEHLSFLTGWFPKLKVLSLTDLPNLKRLEIQQGAMGSLEHLFLIRLSSMTEVPPGIEFVMPLEYLGFHEITGDFLYLLRHCSAIQGTRLRYSLRD

Domains

Domain Start-End Description Sequence

Seg: seg
4-18 seg

IVILLAIKKIGIALA

HMMPanther: PTHR23155:SF207
11-882 OS11G0560000 PROTEIN,OS11G0560000 PROTEIN

KKIGIALASRVANQANVQFGKYKTQLQELHGSMGRVARELRIMHEVLCHMDIRNRNNQVYDGWLEEVQKVAHVMEDMVDEYLYLVGREHDIGSCFYLKKGFRKSRSLLSMNQLAFKVKEIEKDLSHLSETNKRWVPMTISGATSSCDYIVKRGQDLANISRSLDEEDLVGLAENREKLEQWLADDDLECSVIALLGMGGLGKTTLAANVYRNERKKFQCHAWVSISQTYSREDVLRNICKELFKDNVSVLSKSAAMDITCLEETLKSFLEQRKYLIILDDVWTPETFDDLSRMVIHNDKGSRLIITTREGDVAALASPGHILTLEALREDKAWDLFCKKTFPKETNHDCHAELKPLSREIVSRCKGLPLAIVSVASLLRVREKTVEEWRRINNQLSWEIINNSRLDHIRNVLHLSFIYLPTHLKSCFLYCSLFPEDYLLKRKQLVRLWIAEGFIEGRGESTLEEVAEGYLKQLVDRNMLQLVEMNSFGRIKEFKMHDILRELAVDLCQKNCFGVSQEAKCEASLEMDGRRLILDKINNDVQQSFSGLQQLRSAITAGDSKSPFTLLPLLCKESRYMTVLELSGIPIKKIPDAIGDLFNLRHLGLRNSKVKMLPRSVEKLSNLLTLDLCKSDIHELPSGIVKLKKLRHLFVEKIMGPDWRNINHLSGMCIPNGLGNLTNLQTLQALQVQDESLRHLGELRQLKSLRLLNVKGIYCGRISESLVQMRHLSLLSVNASDGNEVLLLNVLLPSLQKLRLRGRLAEGALDESPLFQAVGGQNLYELVLSWSQLTKDPLPSLSRLSSLTRLHFTRAYTGEHLSFLTGWFPKLKVLSLTDLPNLKRLEIQQGAMGSLEHLFLIRLSSMTEVPPGIEFVM

HMMPanther: PTHR23155
11-882 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKIGIALASRVANQANVQFGKYKTQLQELHGSMGRVARELRIMHEVLCHMDIRNRNNQVYDGWLEEVQKVAHVMEDMVDEYLYLVGREHDIGSCFYLKKGFRKSRSLLSMNQLAFKVKEIEKDLSHLSETNKRWVPMTISGATSSCDYIVKRGQDLANISRSLDEEDLVGLAENREKLEQWLADDDLECSVIALLGMGGLGKTTLAANVYRNERKKFQCHAWVSISQTYSREDVLRNICKELFKDNVSVLSKSAAMDITCLEETLKSFLEQRKYLIILDDVWTPETFDDLSRMVIHNDKGSRLIITTREGDVAALASPGHILTLEALREDKAWDLFCKKTFPKETNHDCHAELKPLSREIVSRCKGLPLAIVSVASLLRVREKTVEEWRRINNQLSWEIINNSRLDHIRNVLHLSFIYLPTHLKSCFLYCSLFPEDYLLKRKQLVRLWIAEGFIEGRGESTLEEVAEGYLKQLVDRNMLQLVEMNSFGRIKEFKMHDILRELAVDLCQKNCFGVSQEAKCEASLEMDGRRLILDKINNDVQQSFSGLQQLRSAITAGDSKSPFTLLPLLCKESRYMTVLELSGIPIKKIPDAIGDLFNLRHLGLRNSKVKMLPRSVEKLSNLLTLDLCKSDIHELPSGIVKLKKLRHLFVEKIMGPDWRNINHLSGMCIPNGLGNLTNLQTLQALQVQDESLRHLGELRQLKSLRLLNVKGIYCGRISESLVQMRHLSLLSVNASDGNEVLLLNVLLPSLQKLRLRGRLAEGALDESPLFQAVGGQNLYELVLSWSQLTKDPLPSLSRLSSLTRLHFTRAYTGEHLSFLTGWFPKLKVLSLTDLPNLKRLEIQQGAMGSLEHLFLIRLSSMTEVPPGIEFVM

superfamily: SSF52540
161-412 P-loop containing nucleoside triphosphate hydrolases

KRGQDLANISRSLDEEDLVGLAENREKLEQWLADDDLECSVIALLGMGGLGKTTLAANVYRNERKKFQCHAWVSISQTYSREDVLRNICKELFKDNVSVLSKSAAMDITCLEETLKSFLEQRKYLIILDDVWTPETFDDLSRMVIHNDKGSRLIITTREGDVAALASPGHILTLEALREDKAWDLFCKKTFPKETNHDCHAELKPLSREIVSRCKGLPLAIVSVASLLRVREKTVEEWRRINNQLSWEIINN

Gene3D: G3DSA:3.40.50.300
185-321 no description

REKLEQWLADDDLECSVIALLGMGGLGKTTLAANVYRNERKKFQCHAWVSISQTYSREDVLRNICKELFKDNVSVLSKSAAMDITCLEETLKSFLEQRKYLIILDDVWTPETFDDLSRMVIHNDKGSRLIITTREGD

HMMPfam: PF00931
IPR002182
186-465 NB-ARC,NBS
NB-ARC

EKLEQWLADDDLECSVIALLGMGGLGKTTLAANVYRNERKKFQCHAWVSISQTYSREDVLRNICKELFKDNVSVLSKSAAMDITCLEETLKSFLEQRKYLIILDDVWTPETFDDLSRMVIHNDKGSRLIITTREGDVAALASPGHILTLEALREDKAWDLFCKKTFPKETNHDCHAELKPLSREIVSRCKGLPLAIVSVASLLRVREKTVEEWRRINNQLSWEIINNSRLDHIRNVLHLSFIYLPTHLKSCFLYCSLFPEDYLLKRKQLVRLWIAEGFIE

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

VIALLGMGGLGKTTLA

Seg: seg
203-217 seg

ALLGMGGLGKTTLAA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

FLEQRKYLIILDDVW

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

CKGLPLAIVSVASLL

superfamily: SSF52058
504-913 L domain-like,LRR

KMHDILRELAVDLCQKNCFGVSQEAKCEASLEMDGRRLILDKINNDVQQSFSGLQQLRSAITAGDSKSPFTLLPLLCKESRYMTVLELSGIPIKKIPDAIGDLFNLRHLGLRNSKVKMLPRSVEKLSNLLTLDLCKSDIHELPSGIVKLKKLRHLFVEKIMGPDWRNINHLSGMCIPNGLGNLTNLQTLQALQVQDESLRHLGELRQLKSLRLLNVKGIYCGRISESLVQMRHLSLLSVNASDGNEVLLLNVLLPSLQKLRLRGRLAEGALDESPLFQAVGGQNLYELVLSWSQLTKDPLPSLSRLSSLTRLHFTRAYTGEHLSFLTGWFPKLKVLSLTDLPNLKRLEIQQGAMGSLEHLFLIRLSSMTEVPPGIEFVMPLEYLGFHEITGDFLYLLRHCSAIQGTRLRY

Gene3D: G3DSA:3.80.10.10
542-766 no description

ILDKINNDVQQSFSGLQQLRSAITAGDSKSPFTLLPLLCKESRYMTVLELSGIPIKKIPDAIGDLFNLRHLGLRNSKVKMLPRSVEKLSNLLTLDLCKSDIHELPSGIVKLKKLRHLFVEKIMGPDWRNINHLSGMCIPNGLGNLTNLQTLQALQVQDESLRHLGELRQLKSLRLLNVKGIYCGRISESLVQMRHLSLLSVNASDGNEVLLLNVLLPSLQKLRLR

FPrintScan: PR00364
IPR000767
627-643 DISEASERSIST
Disease resistance protein

EKLSNLLTLDLCKSDIH

Seg: seg
681-696 seg

NGLGNLTNLQTLQALQ

Seg: seg
751-774 seg

LLLNVLLPSLQKLRLRGRLAEGAL

Gene3D: G3DSA:3.80.10.10
786-907 no description

QNLYELVLSWSQLTKDPLPSLSRLSSLTRLHFTRAYTGEHLSFLTGWFPKLKVLSLTDLPNLKRLEIQQGAMGSLEHLFLIRLSSMTEVPPGIEFVMPLEYLGFHEITGDFLYLLRHCSAIQ

Seg: seg
802-815 seg

PLPSLSRLSSLTRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox