PRGDB00077956 (Ta.52772)

From PRG Wiki
Revision as of 18:18, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Ta.52772
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 143315369 (CJ809026)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

CJ809026 Y. Ogihara unpublished cDNA library, whsct Triticum aestivum cDNA clone whsct6p18 5', mRNA sequence

DNA Sequence

CACAAGAAGTTCCTCAGGAGCTTGGTATGGCAATTTTATGGAAATTACCATGATGAGGTCGGAAAGCCTGAACAAGAAAGAAGAGTTGGGGCTGAAATTCTGGCCAACATGGAGAAGATGGATCAAAGAGATTTAGCCCGTATGTGTAATGTGGAGTTGTGTAGGAACAGCTACCTGGTTGTCATAAATGACCTGGTCACCATAGAAGAGTGGCATTTCATTAAGAAGTTATTTCCTGACAACAAGAAACATAGTAGAATCATCGTTTCCACGCAGCAAGCTGAAATTGCAAGCTTGTGCACAGAGAACCCATACCAAGTTTCGGAGTTGGAGCAGTTGTCATGTGATCAAACAATTTATTTGTTCCACaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.52772 translated coding region predicted by ESTScan from UniGene Ta.52772

HKKFLRSLVWQFYGNYHDEVGKPEQERRVGAEILANMEKMDQRDLARMCNVELCRNSYLVVINDLVTIEEWHFIKKLFPDNKKHSRIIVSTQQAEIASLCTENPYQVSELEQLSCDQTIYLFHKKKX

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
37-125 NB-ARC,NBS
NB-ARC

MEKMDQRDLARMCNVELCRNSYLVVINDLVTIEEWHFIKKLFPDNKKHSRIIVSTQQAEIASLCTENPYQVSELEQLSCDQTIYLFHKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox