PRGDB00078685 (Vvi.8296)

From PRG Wiki
Revision as of 18:39, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Vvi.8296
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225434262 (XM_002280661)
Gene Class Mlo-like
Domain Type MLO
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera mildew resistance locus o 15 (MLO15), mRNA

DNA Sequence

AAATGGTTACTGCGCTTTGCTGTTGAATAGCCTATCTAATTTTGATGACTTCCCACCTTACACGGGTGCAACTGTGGAAGGGAACAATAATAGAGTCAAGCCAGGCATAAGGACAGTAGACTAATACGTAAATAGAAGAAAGAATGAGTTTCGGCGTCTAAGTCGGAGCCTGCATCTGCTTCAACTGCTGCCTATATTTAGTATTTACCACACCCGCTGCAGCCATACCACCAACTTTTGATGGCTGTTGCAGGGGAGACAACATTGGAGTATACGCCTACATGGGTGGTTGCAGCCGTCTGCACTGTCATCGTCAGCATTTCTCTTGGTGCCGAACGGATTCTTCATTACGCCGGCAAGTATTTGAAGAAAAAGGACCAGAAGCCTCTGTACGAAGCGTTACTGAAAATCAAGGAAGAGTTGATGCTTCTGGGGTTTATTTCTCTGCTACTCACTGTGTTTCAAGATACAATTGCTAAAATCTGCATCCCAAAAAGGTATTCTGATGACTGGCTTCCTTGTAAGAAGAAAAAAGAGGATTCTTCGAGTTCAGAGGAATCTACATCCCATTTTCAGACCTTCTATCATTTCACCTCTGGGGGTGCCCGTCGACTTCTTGCAGAACACTCTGCTTCCCCCAGTTACTGTGCAAAACGGGGAAAGGACCCACTTTTATCTACCACAGCTTTGCATCATCTTCATATCTTTATCTTCGTGCTAGCAGTTGTGCATGTGATATTTTGTGTTCTAACAATTATTTTTGGAGGAGCAAAGATACGTCAATGGAAGCATTGGGAGGATGCTATCTCAAAAAAGGAATATGATCCTGAAGAGGTGCTGAAGTTCACCAATGTCCGTGAGCATGATTTTATCAAAGATCGATATCGAGGAGTTGGCAAAATTGGCAATTTAAGGGGTTGGGTGCGTTCATTTTTCAAGCAATTTTATGCATCCGTGACCAGATCAGATTATGTCACAATGCGAATGGGCTTCATCATGACCCATTGCAGGGGAAACCCAAAGTTTAATTTTCACAAGTACATGATTCGCGCCCTGGAAGCTGACTTTAAGAGAGTTGTTGGTATAAGTTGGTATCTTTGGATATTTGTGGTTGTTTTCTTGCTGCTGAATGTTAAAGGTTGGCATGCATATTTCTGGATAGCATTCATCCCCTTTATTCTTTTACTTCTTGTGGGGACTAAGCTGGAGCATGTAACCACCCAGTTGGCCCATGAGGTTGCCGAGAAACATGTAGCAATTGAAGGGGACTTGGTTGTTCGACCTTCAGATGATCACTTCTGGTTCCACAGGCCCCAGATTGTGCTATTTCTGATTCAAATCATTCTGTTCCAAAATTCTTTTGAGCTGGCATTTTTCTTCTGGATTTGGGTTCAATATGGCTTTGACTCCTGCATCATGGGACAATTGGGTTTCATTATCCCAAGGCTTTTTATAGGGGCGTTCGTTCAGTTCCTCTGCAGTTACAGTACCTTACCACTCTATGCAATTGTCGCACAGATGGGAAGTTCATTCAAGAGGTCCATATTTGAGGAACATATACAACATGGACTGGTTGAATGGGCACACAAAGCCAAGCTGAAAACGGGTTTTAAAAAGAATGCTAATGGCCCTAGCCAAGTGGGTCCTAAAGAGGTTCCTCCTCCAGCAGTTCAATTGGCAGAAGTTGTGAAGGAATCTGCAGAAGAGAAGGGCAATGTGGGAGAGATTCATCCAGCAACTGGATCGGGTGGATCCAAATGAACACCTTTTATGCTCGCTCTAACTACTTGTATTTGCCACAAACATATAGAAATTAGTTACTAGTCTTTTTGAAATCATACTGCATACTTTGAAAGCCTGTTTTACTCGCACCCCCTAGTAAATTAGTGGAGTGTAAAAGGTATCCTACTGAAAGCAAGGTATTAGTCCAAGGTTTTGCTTGCTCAACTGTAGCGTCTTTTGAAAGAACCCCATGTTGTAGGGTTGATGCTTCTAGCTGTTTTGTGATTGCTTAAGTTTT


Protein sequences

Name Description Sequence
Vvi.8296 translated coding region predicted by ESTScan from UniGene Vvi.8296

XNGYCALLLNSLSNFDDFPPYTGATVEGNNNRVKPGIRTVDXYVNRRKNEFXASKSEPASASTAAYIXYLPHPLQPYHQLLMAVAGETTLEYTPTWVVAAVCTVIVSISLGAERILHYAGKYLKKKDQKPLYEALLKIKEELMLLGFISLLLTVFQDTIAKICIPKRYSDDWLPCKKKKEDSSSSEESTSHFQTFYHFTSGGARRLLAEHSASPSYCAKRGKDPLLSTTALHHLHIFIFVLAVVHVIFCVLTIIFGGAKIRQWKHWEDAISKKEYDPEEVLKFTNVREHDFIKDRYRGVGKIGNLRGWVRSFFKQFYASVTRSDYVTMRMGFIMTHCRGNPKFNFHKYMIRALEADFKRVVGISWYLWIFVVVFLLLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHVAIEGDLVVRPSDDHFWFHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGFIIPRLFIGAFVQFLCSYSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFKKNANGPSQVGPKEVPPPAVQLAEVVKESAEEKGNVGEIHPATGSGGSK

Domains

Domain Start-End Description Sequence

Seg: seg
68-81 seg

XYLPHPLQPYHQLL

HMMPfam: PF03094
IPR004326
87-551 Mlo
Mlo-related protein

ETTLEYTPTWVVAAVCTVIVSISLGAERILHYAGKYLKKKDQKPLYEALLKIKEELMLLGFISLLLTVFQDTIAKICIPKRYSDDWLPCKKKKEDSSSSEESTSHFQTFYHFTSGGARRLLAEHSASPSYCAKRGKDPLLSTTALHHLHIFIFVLAVVHVIFCVLTIIFGGAKIRQWKHWEDAISKKEYDPEEVLKFTNVREHDFIKDRYRGVGKIGNLRGWVRSFFKQFYASVTRSDYVTMRMGFIMTHCRGNPKFNFHKYMIRALEADFKRVVGISWYLWIFVVVFLLLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHVAIEGDLVVRPSDDHFWFHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGFIIPRLFIGAFVQFLCSYSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFKKNANGPSQVGPK

Seg: seg
176-190 seg

KKKKEDSSSSEESTS

Seg: seg
440-452 seg

QIVLFLIQIILFQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox