PRGDB00079733 (Fne.6967)

From PRG Wiki
Revision as of 19:10, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Fne.6967
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 58261347 (XM_568084)
Gene Class Unknown
Domain Type
Gene Species Neslia paniculata

Comment?

Cryptococcus neoformans var. neoformans JEC21 chromosome 12

DNA Sequence

CTCGAGTGCAGTTTGTATTTGTCAACTACATACATATCCATTTAAAGACACCCCATACTATCTTAGCGTAAGCAGTTCAGTACGGTACCAACTCAAAAGCCCCAGAAAAGTAGTCATGTCCGACTTCCATCAAGCTCCCCACAAGCTTTTGGTCATTCCTGGCCCTATCGAGTTCTCTGACCCCGTCCTCGCTGCCAACGCGACTCCCGGTACTGCGCACACATCTCCTGCCTTTATTCCTGTCTTCGGCGAAGCGCTATCTCTCCTTCGTGACGTTCTTTTATCCGCTAAGGAGAGCGGATCCCAACCTCTTCTGATTGCGGGTAGCGGTACTTTGGGCTGGGATGCAGTCGCTGCCAACCTCATTGAGAAAGGTGAAGAGGCTGTTGTCCTCAACACTGGCTACTTTAGTGACTCTTTCGGCGAGTGCCTCGAAGCTTACGGTGCCAAGGTTACTCATGTGAAGGCCGAGGTCGGTGGCATTCCTACTGATGATGCCATTATCTCAGCCCTGGCTTCTAAGCCTAAGCTTCTTACCATCACCCATGTCGACACTTCCACCGGTGTCCTTTCACCAGCTGATCACATAGCTTCTCTTGTTAAGAAGCACTCTCCTGACACCCTCATTGCTCTTGACGCCGTGTGCTCAGTGGCTTCCGAAGAAATCAAGTTTGACGAATGGGGACTGGATGTCGTCCTCAGCGCTACTCAGAAGGGCCTTGGTGTACCTCCTGGTTTGAGCGTTGTGCTTGCCAGCAAGAGGGCTGTGGAGACCGTTGAGAAAAGGAAGACTCCTATCCCCGCTTACTATGTCTCTTGGAAGAAGTGGATCCCCATTATGCAGAACTACGAAAGCGGAAAGCCATCTTACTTTGCTACTCCCCCCGTCCAGCTCGTCTATGCGCTTCACACCTCTCTCAAATCCATTACTTCTGCACCTCTGGCAGACCGTTTCAAGGCTCACAAGGCTGCCAGCGCCTATGTTAAGGACAGCCTCGCCGAACTTGGTCTTGAATTCGTCCCCAAGAGCCGTGACATTGCTGCGAACGGTATGACCGCTGTCAGGTTCCCTAAAGGTGTGAAGGCGCCCGATGTCCTTCCTAAATTGGCCGAGCGAGACATCGTTGTGGCCGCTGGCTTGCATAAGGCCATTGTTAGCGAATACTTTCGAATCGGACACATGGGTATCACCGCTGTCGACAGGCAAAGGGGCGATCTGGAAAAGGTTGTCAAGGGTATCAAGGAGGTTTTGGGCAAGGCTTGAATCTCTAGCACAAATATTGAAGGTTATAGAGCCAAGCTGTAAATGCGATAAAAACGCATCGAAGTGGAAGAAGATCATATGGCTACTCTTTTGGGAGATAGCAATTTGTATGAATAGCCCCTGAAGGCTTATTTTAAATCT


Protein sequences

Name Description Sequence
Fne.6967 translated coding region predicted by ESTScan from UniGene Fne.6967

XSSAVCICQLHTYPFKDTPYYLSVSSSVRYQLKSPRKVVMSDFHQAPHKLLVIPGPIEFSDPVLAANATPGTAHTSPAFIPVFGEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSFGECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIASLVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAVETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPLADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAERDIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVLGKA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
39-418 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VMSDFHQAPHKLLVIPGPIEFSDPVLAANATPGTAHTSPAFIPVFGEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSFGECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIASLVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAVETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPLADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAERDIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVL

HMMPanther: PTHR21152
39-418 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

VMSDFHQAPHKLLVIPGPIEFSDPVLAANATPGTAHTSPAFIPVFGEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSFGECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIASLVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAVETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPLADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAERDIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVL

superfamily: SSF53383
IPR015424
46-418 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

APHKLLVIPGPIEFSDPVLAANATPGTAHTSPAFIPVFGEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSFGECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIASLVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAVETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPLADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAERDIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVL

Gene3D: G3DSA:3.40.640.10
IPR015421
62-300 no description
Pyridoxal phosphate-dependent transferase, major r

PVLAANATPGTAHTSPAFIPVFGEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSFGECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIASLVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAVETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLV

HMMPfam: PF00266
IPR000192
106-385 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSFGECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIASLVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAVETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPLADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAERDIVVAAGLHKAI

PatternScan: PS00595
IPR020578
230-250 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

LDVVLSATQKGLGVPPGLSVV

Gene3D: G3DSA:3.90.1150.10
IPR015422
301-420 no description
Pyridoxal phosphate-dependent transferase, major r

YALHTSLKSITSAPLADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAERDIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVLGK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox