PRGDB00079749 (Fpr.1080)

From PRG Wiki
Revision as of 19:11, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Fpr.1080
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237587386 (GO861064)
Gene Class Unknown
Domain Type LRR
Gene Species Capsella grandiflora

Comment?

CLS_CLiFpEfSpn_39a4_1_n12cLibkit5LD_G06 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 39n12 5', mRNA sequence

DNA Sequence

AACTCAATTAGAGCAAGAATAGAGACATGGCTCAAGTTCCTGCAGCCAAATCTTTGATTGCTCCTTCTCACCATGAACTCTTTCTTCTCTGCACCCTCATATTTTTGTACTCCAACAGCATAATATTCTCATCAGCACAAGCTACCAACACAACCGAGGATGACCGGCAAGCCCTTCTCTGCTTCAAATCTAGCATCTCCAGTGATCCTACTGGTGTTCTTGGATCATGGCGCAACGATTCCCTCAACTTCTGTGGCTGGCAGGGGGTCACCTGCAGCATGACCCTCGCAATCCGTGTCGTGTCCATCCAATTCAGGTCTGCGCTGCTCACAGGAACACTATCCAGTTGCATGTCAGGCCTTACTTCTCTAGTTCAGATGGATCTTCGAAACAATAAATTGTCTGGAAGCATACCTGATGAGATAGGTGAGCTTCCTAGCCTACAAACTTTGATGCTTGCCGACAACGGGCTTGCAGGTAACATCCCTCTGTCATTAGGTACAGCTGCATCTCTTAGATATGTCAACCTTGCAAACAATTCTCTTAGCGGAGTTATCCCTGATTCCTTATCAAACAGTTCGTTACTAAGTGAGCTAATCCTCTCACGTAACAACTTAGCTGGGGAGATCCCGGCTAATCTGTTCAACTCATCGAAACTTGTCGCTGTTGATCTCCAGTGGAATTTTCTCTCAGGAGAAATCCCACATTTCCAGGAGATGGATGCTCTGCAATTTCTTAACCTTACAGGGAATTTACTTTCTGGTACTATACCAGCATCTTTGGTAAATGTTTCATCCTTGCGTTGTCTCCTGCTAGCACAAAACAACTTGACAGGATCAATCCCAGAAACTTTAGGTCAAATTCCAAGCCTAACAATTCTAGATCTAAGTTACAACGGATTCTCAGGTATGTCCCAACCACACTGTATAATGTCTCGGCACTCACACTCTTTAGCTTAGGGCTTCAACAATTTTATTGGACAGATACCTTCTGAAATTGGCCACTCGCTTCCGATCTCAACATGGTAATGGGTGGCAACAAATT


Protein sequences

Name Description Sequence
Fpr.1080 translated coding region predicted by ESTScan from UniGene Fpr.1080

MAQVPAAKSLIAPSHHELFLLCTLIFLYSNSIIFSSAQATNTTEDDRQALLCFKSSISSDPTGVLGSWRNDSLNFCGWQGVTCSMTLAIRVVSIQFRSALLTGTLSSCMSGLTSLVQMDLRNNKLSGSIPDEIGELPSLQTLMLADNGLAGNIPLSLGTAASLRYVNLANNSLSGVIPDSLSNSSLLSELILSRNNLAGEIPANLFNSSKLVAVDLQWNFLSGEIPHFQEMDALQFLNLTGNLLSGTIPASLVNVSSLRCLLLAQNNLTGSIPETLGQIPSLTILDLSYNGFSGMSQPHCIMSRHSHSLAXGFNNFIGQIPSEIGHSLPISTWXWVATNX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
5-325 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PAAKSLIAPSHHELFLLCTLIFLYSNSIIFSSAQATNTTEDDRQALLCFKSSISSDPTGVLGSWRNDSLNFCGWQGVTCSMTLAIRVVSIQFRSALLTGTLSSCMSGLTSLVQMDLRNNKLSGSIPDEIGELPSLQTLMLADNGLAGNIPLSLGTAASLRYVNLANNSLSGVIPDSLSNSSLLSELILSRNNLAGEIPANLFNSSKLVAVDLQWNFLSGEIPHFQEMDALQFLNLTGNLLSGTIPASLVNVSSLRCLLLAQNNLTGSIPETLGQIPSLTILDLSYNGFSGMSQPHCIMSRHSHSLAXGFNNFIGQIPSEIG

HMMPanther: PTHR24420
5-325 FAMILY NOT NAMED,FAMILY NOT NAMED

PAAKSLIAPSHHELFLLCTLIFLYSNSIIFSSAQATNTTEDDRQALLCFKSSISSDPTGVLGSWRNDSLNFCGWQGVTCSMTLAIRVVSIQFRSALLTGTLSSCMSGLTSLVQMDLRNNKLSGSIPDEIGELPSLQTLMLADNGLAGNIPLSLGTAASLRYVNLANNSLSGVIPDSLSNSSLLSELILSRNNLAGEIPANLFNSSKLVAVDLQWNFLSGEIPHFQEMDALQFLNLTGNLLSGTIPASLVNVSSLRCLLLAQNNLTGSIPETLGQIPSLTILDLSYNGFSGMSQPHCIMSRHSHSLAXGFNNFIGQIPSEIG

superfamily: SSF52058
40-321 L domain-like,LRR

TNTTEDDRQALLCFKSSISSDPTGVLGSWRNDSLNFCGWQGVTCSMTLAIRVVSIQFRSALLTGTLSSCMSGLTSLVQMDLRNNKLSGSIPDEIGELPSLQTLMLADNGLAGNIPLSLGTAASLRYVNLANNSLSGVIPDSLSNSSLLSELILSRNNLAGEIPANLFNSSKLVAVDLQWNFLSGEIPHFQEMDALQFLNLTGNLLSGTIPASLVNVSSLRCLLLAQNNLTGSIPETLGQIPSLTILDLSYNGFSGMSQPHCIMSRHSHSLAXGFNNFIGQIP

Gene3D: G3DSA:3.80.10.10
42-218 no description

TTEDDRQALLCFKSSISSDPTGVLGSWRNDSLNFCGWQGVTCSMTLAIRVVSIQFRSALLTGTLSSCMSGLTSLVQMDLRNNKLSGSIPDEIGELPSLQTLMLADNGLAGNIPLSLGTAASLRYVNLANNSLSGVIPDSLSNSSLLSELILSRNNLAGEIPANLFNSSKLVAVDLQW

HMMPfam: PF08263
IPR013210
44-84 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDDRQALLCFKSSISSDPTGVLGSWRNDSLNFCGWQGVTCS

HMMPfam: PF00560
IPR001611
114-135 LRR_1
Leucine-rich repeat

SLVQMDLRNNKLSGSIPDEIGE

HMMPfam: PF13855
162-219 LRR_8,Leucine rich repeat

SLRYVNLANNSLSGVIPDSLSNSSLLSELILSRNNLAGEIPANLFNSSKLVAVDLQWN

Seg: seg
180-197 seg

SLSNSSLLSELILSRNNL

Gene3D: G3DSA:3.80.10.10
219-326 no description

NFLSGEIPHFQEMDALQFLNLTGNLLSGTIPASLVNVSSLRCLLLAQNNLTGSIPETLGQIPSLTILDLSYNGFSGMSQPHCIMSRHSHSLAXGFNNFIGQIPSEIGH

HMMPfam: PF13855
234-291 LRR_8,Leucine rich repeat

LQFLNLTGNLLSGTIPASLVNVSSLRCLLLAQNNLTGSIPETLGQIPSLTILDLSYNG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox