PRGDB00080625 (Mgu.20066)

From PRG Wiki
Revision as of 19:37, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Mgu.20066
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238204413 (GR080030)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF14461.g1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF14461 3', mRNA sequence

DNA Sequence

GATAAAAAAGAATTGTTCCGAGTATTCCTTTGAGATATAGCCAGCATTCAACAAATTTACCTACCAAACACTAATGAAGGATATTTTTTACCGACACTTTTGAGCTCGTAATCAGAATCTCCTTCATTTACAAAACAAACTAGCCTTTACATCTACCACATGATAATGTAGAAAAAAATTACGTGCGTGGTGGGAGAGGATATGCTCGATGTGGTTCTTGCCTAGGATGATGATGTGGAGAACGATGATGATGGTGATGATGCCTGGGTGATCTGTTATTATTATAAGCTGGTGTATGATTATTAGTAGAATGGAGTGATGCAGGCGGCCTGTCCTTGGCAGCAGAGTCGATTCTTTCAAGTGTGTCAACAAGCTCTTGCATTGAAGGTCGATTCTTCTGTTCGTTTTCAAGACAAGTGAGAGTGAGTTGAGCAATTTGGAAAGCGGATCTTGATGGATATCTTCCTTCCAAACGAGAATCCATAACTGTCTTCAACTTCCTCCTGTCCGATAGATATGGCTTTATCCAATCTACCAGATTCTGCTGTCCAGATGGCCGGTTTGTGTCCATTGCACCCAAACCAGTCAGCATTTCTACTAACACCACACCAAAACCGTACACGTCACTCTTCACGTACAAGTGCCCTGTGGCGACGTACTCTGGTGCAGCATAGCCTTGGGTTCCCATAACCTGTGTGGTGATGTGAGATTTACTAGCCGTTGGACCCATTTTAGCCAGACCGAAATCAGATATCTAGCATTGTATGACCCATCGAGCA


Protein sequences

Name Description Sequence
Mgu.20066 translated coding region predicted by ESTScan from UniGene Mgu.20066

MGPTASKSHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVDTLERIDSAAKDRPPASLHSTNNHTPAYNNNRSPRHHHHHHRSPHHHPRQEPHRAYPLPPRT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-127 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MGPTASKSHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVDTLERI

HMMPanther: PTHR24420:SF531
1-135 SUBFAMILY NOT NAMED

MGPTASKSHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVDTLERIDSAAKDRP

HMMPanther: PTHR24420
1-135 FAMILY NOT NAMED,FAMILY NOT NAMED

MGPTASKSHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVDTLERIDSAAKDRP

HMMPfam: PF00069
IPR017442
7-122 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KSHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVD

Gene3D: G3DSA:1.10.510.10
8-161 no description

SHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVDTLERIDSAAKDRPPASLHSTNNHTPAYNNNRSPRHHHHH

superfamily: SSF56112
IPR011009
9-132 Protein kinase-like (PK-like)
Protein kinase-like domain

HITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLENEQKNRPSMQELVDTLERIDSAAK

Seg: seg
153-175 seg

RSPRHHHHHHRSPHHHPRQEPHR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox