PRGDB00081100 (Pvr.38496)

From PRG Wiki
Revision as of 19:52, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pvr.38496
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 198385184 (GD049687)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Saccharum hybrid cultivar

Comment?

CCHZ29519.b1 CCHZ Panicum virgatum abiotic and biotic stress treatments (N) Panicum virgatum cDNA clone CCHZ29519 5', mRNA sequence

DNA Sequence

ATTGCCGTGAAGGTTCTTAACTTGCAACAACGTGGGGCAGCACAAAGCTTTCTTGCAGAATGTGAGACTCTCAGAAGCGTTCGGCATCGTAACCTTGTGAAGATCTTGACAGTTTGCTCGAGTATTGATTTTCAGGGTCATGACTTCAAGGCTCTGGTATATGAGTTTTTACCAAATGGAAATTTAGACCAATGGCTACACCAGTATCCTGAGGAAAATGGTGAAAATAGTGCCGTGAATATTATCAGAAGGCTCAGCATCGCCACTGATGTGGCTTCTGCTCTTGATTATATGCACCATCACAGGCCATCACCAATTATTCACTGCGATCTCAAGCCAAGCAACATTCTCCTTGATAATGATATGGTTGGGCATGTTGCTGACTTTGGGCTTGCAAGAGTCCTGCATCAAGATCATAGTGTCATATCAGAGAAATCAAGTGGGTGGGCTACAGTGAGAGGAACAATTGGCTATGCTGCTCCAGAGTATGGTTTGGGCAACAAAGTTTCAATCCAGGGTGATGTCTACAGCTATGGCATATTGTTGCTGGAGATGTTTACTGGAAAAAGACCGACAGACAGTGAATTCGAAGAAGGACTCAGCCTTCGTAAATATGTTCAGACAGCACTTCCAGAAAGGGTGATCAATATTGCAGACCAGAAGCTGTTATCAAAGGATGGGGATGAACAACAAGGAATCTCAAACTCAGTCAAAATAAGAGATGCAAGAATCGCTTGCATCACATCGGTCCTGCAGATTGGAATTTCATGTTCAAACGATAA


Protein sequences

Name Description Sequence
Pvr.38496 translated coding region predicted by ESTScan from UniGene Pvr.38496

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEEGLSLRKYVQTALPERVINIADQKLLSKDGDEQQGISNSVKIRDARIACITSVLQIGISCSNDX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-195 Protein kinase-like (PK-like)
Protein kinase-like domain

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSE

ProfileScan: PS50011
IPR000719
1-261 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEEGLSLRKYVQTALPERVINIADQKLLSKDGDEQQGISNSVKIRDARIACITSVLQIGISCSNDX

Gene3D: G3DSA:3.30.200.20
1-57 no description

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFL

HMMSmart: SM00219
IPR020635
1-223 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEEGLSLRKYVQTALPERVINIADQKLL

HMMPanther: PTHR24420:SF474
1-260 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEEGLSLRKYVQTALPERVINIADQKLLSKDGDEQQGISNSVKIRDARIACITSVLQIGISCSND

HMMSmart: SM00220
IPR002290
1-238 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEEGLSLRKYVQTALPERVINIADQKLLSKDGDEQQGISNSVK

HMMPanther: PTHR24420
1-260 FAMILY NOT NAMED,FAMILY NOT NAMED

IAVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEEGLSLRKYVQTALPERVINIADQKLLSKDGDEQQGISNSVKIRDARIACITSVLQIGISCSND

HMMPfam: PF00069
IPR017442
2-197 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

AVKVLNLQQRGAAQSFLAECETLRSVRHRNLVKILTVCSSIDFQGHDFKALVYEFLPNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFE

Gene3D: G3DSA:1.10.510.10
58-198 no description

PNGNLDQWLHQYPEENGENSAVNIIRRLSIATDVASALDYMHHHRPSPIIHCDLKPSNILLDNDMVGHVADFGLARVLHQDHSVISEKSSGWATVRGTIGYAAPEYGLGNKVSIQGDVYSYGILLLEMFTGKRPTDSEFEE

PatternScan: PS00108
IPR008271
106-118 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDLKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox