PRGDB00150844 (Cre13.g592000.t1.1)

From PRG Wiki
Revision as of 03:48, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Cre13.g592000.t1.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

SNF1 kinase homolog 10 (best arabidopsis hit)

DNA Sequence

ATGCCCCCAGCAAAGGACGGGAAGGAGGGATTTCTCTCTAATCTTCTTAGCAAACTGGGCAAAAAGAAGAAGCCTAAAGCGGATAAGGCAGCGGAGGTCCTCGCGCCCGCTGCGGACCCACCAAAGCCAGCAATCCAGCCAACGCAGGCAGTGCCGCCTGTGCCTGCAGCGGATGCGGGCGCGAAACTTGAGCCAGATACGGATGCTGCTGGACTCAAACTGGCTGGCCCGTCTCAGCCTGACTCAAGCGGCCATGGCCATGCGCCAAATGACTCGTCGGTTGTGCCTCCTGCGGTCGCGCATGACAAGTTGCTCGCGGCGCTGGAGTCTCGAAATCCCACCGATCCTATTGGCAACAGCAACCCGGGCGGCAACAGTGGCGCGCGCGTGGGCACCTTCAACGCGGCGGACCTGGCGGGTGTGCTGTTCGCGCAGCGCACCAACACGCAGACCTCCAACACGGGCGGGGGCTTGGGCCTGGGCATGGTGCTCCCGGCGCGCATGGCAGACGCCATGTCCTCAACCGTCAACTCAGCCGAGGTGCCGCAACACCGGCAGCAGGCGCTGCTGGAAGACGCGACGCGCGGCTCGTACATCCCCTCCACCGTCGGCCCCATGCTGAGCCATGCGCAAAACACGCAGGACAGCAACACCGTCAACAGCAACACTCAAAATCTGCAGGACATACTGTACGGGGACTATGACGCCCTGGATCGGAGCCAGGGCCGGCCGTCGGCGCCGCTGGGTTCGGCGCCCCTGGGTTCAGCAGGCGTGAGCCGGTCGCTGCGGCCACCTTTGGGGCAGTCACTGCTGGGCATGCCGGGGCCGGGGGGCTCCGGGGGGCCGCACGCGGCGCACGCGCAGACCACAACACAGTTGCAGGAGCTATCTGACATGCAACAGCAGGGTCAGGGCCACACATTACACCCGACCACCAGTTCCCTGGCGGTGCCCGGCAGCCACCCGCCCGGCAACGCGGCGGCAGCTGCTCTGGCCGCCGCGGGTCAAGTACAGACCCGCTCCGCGCCACTGGTCCACGTCCCGCCGGAGCAGCAGGTGCAGCACCTGGAGCAGGTGCTGGAGGCGCAGCAGGCCCCGGCGCCCTCCGCGGCGCAAACGAGCCAGCACGGAGGCATGGTGGACGGCGGCCGAGGGCAGCGCACTTCGGACCCGCACACGCGGCCGCCATTTCCTGTTGGCGCGGCGTCTGCCGACCTGCCAAACCTGCCGGCTGCTACGGAAGCGCAGGCGGCGGCGCCAGGTGATACGGCGCAACCGCCGCACAACGGCGTGCCCAGCGCTGCGGTTGCGGCCGTGGCCAACGGCGCACACGCCAGCCGTTCGGTTGCGGTGGAGCCGGTTAACGTCAGCTCGCCACAGGGTAAGGTGCCGGCAACAGAGGCGCCACCAGGCCCAGCGGCGGGCCCGGCGCGGCCGGATGCGCCCGGCACGCAGCCACATTCCCATCAGCAGCAGCAGCAGCAGCGGCAGGCTGCACCTGTTGCTAAGGAACATGGGACCGTGGACGCCGGAGCTGCACCTGCGTCAGTGGCTGCGCAACCGAGTGCTGCAGCGGCTTCTAGTGCTATGGCGCGGCCAGCCGCCCCGCCGCTGGCATTTCGAAACACGGGCGCCATGCCGGGCACCCTAGCCTCCTTTGGGCCGCTCCCACCCATCCACAGCACGCCCGCTCCGCCGCCGCCCGCGCCCGTGTCCACGCTGCCCAACTCGCTTGCGCCCGCGCCGCTGCCGAGCTACCAGCAGACGACGCACGTGCCGTCGGGTGTGCACGGTGACCAGCCCGTGCCGCTCAGCCGGCCCATGAAGCTGACCACGGCCTGCCTGGGCGCACACACGACGCTGTGCGACAGCGCCGCCGACCAGAGCTTCCAGAAAGCCATGCAGCGCAAGATGCAGATGGTGTTCAAGTGGCTGCAAGCCTCCGACCTCGACGCGCCGCCCGACCCCAGGCTGGAGATCCCGCTGCCGCCGCAGCCCGAGGGCGGTGCCGTGGCAGACGCAGCGGCGGTACAAGGGACGGCCACCGCGGTGTCGCCAGGGGCTGCTACGCGGGACGGCGCACAGGCAGGAGCGAGTGCGGCAGCCGCACCAGCACACATCCTGACGGATGGCCCGGTGCCGTTGACGGAAGCGGCGATGGCGGCCCACATGGCGGGCGGCGGCAAGCCCGGCGTGCCCCCGCACCACCCCTACCATATGCCCTCACCCCAGCAGCTTGCAGTGGCGGCGCAGCCGCAACCGCAGCCGCAGCCGCACCAACCACAACCGGCGCCGCAGCAGGCACAGCTCACGTCAGCTCCCGGACCTGGACCCGCGCAGTTCGCACATGCACCGCAAGCGGGCCCCCGGCACGCCGCTGACGTGCACCAGCACACAGCGCTGCACAAGCACGCGGCGGCTGCGGCCTCGGCACCCGTGGCCCCCGCGGTCGTACCTGCGCAACTGGCCAGCGCCCCCGCTGGTGCAGGCCACATCCTCTCCTCCGGCCCCCCTCAGCAGCCGCAACAGCAGCCGCACGACCCGCAGGGCGCCCACACAGTGGCGGCGACGCTTGAGCAGCCCGGCCTGTCGGGCGGCGGCGACCGCGGCCAGCACCGCAACGTGCCGCCGTCGTCCTCACCCCAGGCCGTCAATCGCATACCCGGCGGCAACGACGTCAGCGCCAGCGCCACTGTTGCCGCGCAGGCGCTCGGGCTGCCGGATGCTATGCTGCAGCACAGCCTGTCAGATCTGTACGCCAGCGGGCAGGCGGGCCTGGGCACAAACATGCCGCAGCGCGTGCTGCAGGGCAGTGACGACGCATTCGCGGCAGGGCCGGGCGCAGCTGCCGTCGCTGCAGCTGCTGCTGCCGCCGCAGCCGCGGCGGCCGCGGGCGTGTCTGGCGGGGGGGCGCCGGCGGCGGTTGGTGGGATTGGCTCGGCGAACTCGTTCAAGGGCAGTGGGGGCGGCCAGCAGGCCGTCATCTCGGGCAGCCGAGACGGGCTTGTGTCTGCGGGCGGCGTGCGGCACACGTCCGGCCACGCGCCGCCGGCGCGCACGAAGACCATCGCCGTGGCCAGCCACTGCCCTGCGGAGCTGCAGCCCTCGCCGCCGTCCGCCTCCTGGACCATCGATGACTTCCACCTGTTGAAGAAGCTGTATGAGGGCAGCCTGTCGGTGGTGTGCCAGGCGCAGCACCGGCGCAGCGGGCGGCACGTGGCGCTCAAGATCTACAAGCGCTCGCGGCTGCACGAGATGGAGCGGTTCCAGCTGGCTCGTGAGATCTGCCTGCACATCCGCATCGTGCACCCCTACGTGGTGGCGCTGTACGCGGCGTGGAAGGACTCCAAATACGTCTACCTGGCGCTGGAGTGGGCGCCGCAGGGCAACATGTTTGACTTCCTGGTGTCTCGCGGCGGGCGGCTGGGCGAGGAGGAGGCGGCGCGCGTGGTAATGAAGCCGCTCATGGGCGCGCTGGCCTTCCTACACAGCCAGAGCTTCCTGCACAGGGATGTGAAGCTGGAGAACCTGCTGCTGGACGCCTCCTGCAACCTCAAGCTGGCGGACTTCGGACTGGCCATCGACCAGAAGTTCGAGCAGGCAAACACGCGGCTAGGCACGTTCGGCTACTTCGCGCCGGAGGTGCTGGACTGCCCGCTGAAGAAGGGCCCCTTCGACCTAAAGGACACGTCTGTGCCCGGCTACGACAGCCGTGTGGACGTGTGGAGCGCGGGCGTGGTGGGCTACGAGGTGCTGACGGGGCGGGCGCCCTTCAGCGCCTCCTCGCCCGCCAAGATCATTCAGGCAATCCGCACGCGTGTGCTGGAGTTTCCGGGTGTGAGCGAGGACGGCAAGGACTTTCTGCGCCAGGCGCTCACACGAGACCCCGCGCTGCGCCCCACCGCCAAGCAGATGCTGGCACACCCCTGGATCCTGCGGCACTGCGGCGGCGCCGCCGCGGCTGCGGCCGCAGCGGCGTCAGCGCTCAGCACCGTGCCGCCGCCGCTGATGCCGCTCCCTGCGGCGGATACGCAGGGGTCCGGCGGCGCGGCGTCCAGGCACACTGGCGGCAGCGGCGGAGTGGCAAGCGGGGGGCCGGGTGCAGCAAGTGCACCGGCGGCAGCGGTCAATGGCGGCGCCCCGCAAGGGGTAGAGGTGGAGGCTGGAGGCGTCATTCGGCAATAA


Protein sequences

Name Description Sequence
Cre13.g592000.t1.1 SNF1 kinase homolog 10 (best arabidopsis hit)

MPPAKDGKEGFLSNLLSKLGKKKKPKADKAAEVLAPAADPPKPAIQPTQAVPPVPAADAGAKLEPDTDAAGLKLAGPSQPDSSGHGHAPNDSSVVPPAVAHDKLLAALESRNPTDPIGNSNPGGNSGARVGTFNAADLAGVLFAQRTNTQTSNTGGGLGLGMVLPARMADAMSSTVNSAEVPQHRQQALLEDATRGSYIPSTVGPMLSHAQNTQDSNTVNSNTQNLQDILYGDYDALDRSQGRPSAPLGSAPLGSAGVSRSLRPPLGQSLLGMPGPGGSGGPHAAHAQTTTQLQELSDMQQQGQGHTLHPTTSSLAVPGSHPPGNAAAAALAAAGQVQTRSAPLVHVPPEQQVQHLEQVLEAQQAPAPSAAQTSQHGGMVDGGRGQRTSDPHTRPPFPVGAASADLPNLPAATEAQAAAPGDTAQPPHNGVPSAAVAAVANGAHASRSVAVEPVNVSSPQGKVPATEAPPGPAAGPARPDAPGTQPHSHQQQQQQRQAAPVAKEHGTVDAGAAPASVAAQPSAAAASSAMARPAAPPLAFRNTGAMPGTLASFGPLPPIHSTPAPPPPAPVSTLPNSLAPAPLPSYQQTTHVPSGVHGDQPVPLSRPMKLTTACLGAHTTLCDSAADQSFQKAMQRKMQMVFKWLQASDLDAPPDPRLEIPLPPQPEGGAVADAAAVQGTATAVSPGAATRDGAQAGASAAAAPAHILTDGPVPLTEAAMAAHMAGGGKPGVPPHHPYHMPSPQQLAVAAQPQPQPQPHQPQPAPQQAQLTSAPGPGPAQFAHAPQAGPRHAADVHQHTALHKHAAAAASAPVAPAVVPAQLASAPAGAGHILSSGPPQQPQQQPHDPQGAHTVAATLEQPGLSGGGDRGQHRNVPPSSSPQAVNRIPGGNDVSASATVAAQALGLPDAMLQHSLSDLYASGQAGLGTNMPQRVLQGSDDAFAAGPGAAAVAAAAAAAAAAAAAGVSGGGAPAAVGGIGSANSFKGSGGGQQAVISGSRDGLVSAGGVRHTSGHAPPARTKTIAVASHCPAELQPSPPSASWTIDDFHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWILRHCGGAAAAAAAAASALSTVPPPLMPLPAADTQGSGGAASRHTGGSGGVASGGPGAASAPAAAVNGGAPQGVEVEAGGVIRQ*

Domains

Domain Start-End Description Sequence

Seg: seg
15-31 seg

LLSKLGKKKKPKADKAA

Seg: seg
43-61 seg

PAIQPTQAVPPVPAADAGA

Seg: seg
118-127 seg

GNSNPGGNSG

Seg: seg
264-282 seg

PPLGQSLLGMPGPGGSGGP

Seg: seg
326-334 seg

AAAAALAAA

Seg: seg
347-375 seg

VPPEQQVQHLEQVLEAQQAPAPSAAQTSQ

Seg: seg
410-427 seg

PAATEAQAAAPGDTAQPP

Seg: seg
431-448 seg

VPSAAVAAVANGAHASRS

Seg: seg
464-483 seg

PATEAPPGPAAGPARPDAPG

Seg: seg
490-497 seg

QQQQQQRQ

Seg: seg
510-539 seg

AGAAPASVAAQPSAAAASSAMARPAAPPLA

Seg: seg
555-585 seg

PLPPIHSTPAPPPPAPVSTLPNSLAPAPLPS

Seg: seg
653-667 seg

PPDPRLEIPLPPQPE

Seg: seg
668-684 seg

GGAVADAAAVQGTATAV

Seg: seg
687-705 seg

GAATRDGAQAGASAAAAPA

Seg: seg
718-739 seg

AAMAAHMAGGGKPGVPPHHPYH

Seg: seg
741-769 seg

PSPQQLAVAAQPQPQPQPHQPQPAPQQAQ

Seg: seg
805-827 seg

AAAAASAPVAPAVVPAQLASAPA

Seg: seg
837-849 seg

PPQQPQQQPHDPQ

Seg: seg
943-981 seg

AAGPGAAAVAAAAAAAAAAAAAGVSGGGAPAAVGGIGSA

Gene3D: G3DSA:3.30.200.20
1011-1158 no description

TSGHAPPARTKTIAVASHCPAELQPSPPSASWTIDDFHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGA

superfamily: SSF56112
IPR011009
1029-1371 Protein kinase-like (PK-like)
Protein kinase-like domain

CPAELQPSPPSASWTIDDFHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWILRHCGGAAAAAAAAASALSTVPPPLMPLPAADTQGSGGAASRHTGGSGGVASGGPGAASA

HMMSmart: SM00219
IPR020635
1047-1311 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWI

HMMPfam: PF00069
IPR000719
1047-1311 Pkinase,Ser-thr
Protein kinase, catalytic domain

FHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWI

HMMSmart: SM00220
IPR002290
1047-1311 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWI

ProfileScan: PS50011
IPR000719
1047-1311 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHLLKKLYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWI

HMMPanther: PTHR26263:SF49
1053-1340 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWILRHCGGAAAAAAAAASALSTVPPPLMPLP

HMMPanther: PTHR26263
1053-1340 FAMILY NOT NAMED,FAMILY NOT NAMED

LYEGSLSVVCQAQHRRSGRHVALKIYKRSRLHEMERFQLAREICLHIRIVHPYVVALYAAWKDSKYVYLALEWAPQGNMFDFLVSRGGRLGEEEAARVVMKPLMGALAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWILRHCGGAAAAAAAAASALSTVPPPLMPLP

Gene3D: G3DSA:1.10.510.10
1159-1312 no description

LAFLHSQSFLHRDVKLENLLLDASCNLKLADFGLAIDQKFEQANTRLGTFGYFAPEVLDCPLKKGPFDLKDTSVPGYDSRVDVWSAGVVGYEVLTGRAPFSASSPAKIIQAIRTRVLEFPGVSEDGKDFLRQALTRDPALRPTAKQMLAHPWIL

PatternScan: PS00108
IPR008271
1167-1179 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FLHRDVKLENLLL

Seg: seg
1318-1328 seg

AAAAAAAAASA

Seg: seg
1356-1384 seg

GGSGGVASGGPGAASAPAAAVNGGAPQGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox