PRGDB00150849 (Cucsa.001360.1)

From PRG Wiki
Revision as of 03:47, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Cucsa.001360.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Pennisetum glaucum

Comment?

transmembrane kinase 1 (best arabidopsis hit)

DNA Sequence

ATGGAGAAGAAGAAAACCCATTTCGTAAACAAGCATTTTCTCATCTTAGCCATCTTCTCAATCTTCCACTCTGTTGAACCCCAAGAACTTAGCCCTGATGCTCCTGCAATGACGGCTCTCAAAAAGAGCCTAAACCCAACTGAATCCCTTGGCTGGTCCGACCCCAACCCTTGCAAATGGAACCACGTCCTCTGTTCTGATGACAATCGTGTCACTCGAATCCAAATCGGCCGCCAAAATCTCCAAGGTATGCTCCCTTTAAATCTCCAAAATCTCACAGCTCTTGAGCGATTAGAGCTTCAATGGAACAAAATCTCTGGCCCTTTGCCGAGTTTGAGTGGATTAACCTCTTTGCAAGTGCTTTTGCTTAGTGGGAATCAGTTCACTTCCATTCCGTCCGATTTCTTCGCCGGAATGACCTCTCTTCAGGCCGTTGAGATCGACGAAAACCCCTTTTCAGCTTGGGAGATTCCGGCCAGTCTACGAAATGCTTCTACGCTACAGAACTTCTCAGCCAACTCTGCAAATGTTACCGGTCGGATTCCGGAGTTTCTCGGCGGCGAGGACATTCCGGGGCTTACTAATTTGCATCTTGCTTTTAATAATCTTGAAGGGGGTCTTCCTTCCAGCTTTTCTGGATCTCAATTGGAGTCTTTGTGGGTTAATGGACAAAACAGCGCTGATAAACTTAGTGGGAGTATTGATGTTTTGCAGAACATGACTTCTTTGATTGAAGTTTGGTTGCATTCGAATTCATTTTCAGGTCCTTTGCCAGATTTTTCGAGGTTAAAGGATTTGCAGGCGTTGAGTTTAAGAGATAACAAGTTTACTGGTCCTGTTCCAAGTTCTTTGGTGAATTCTCCATCGTTGAAAGTGGTGAATTTGACTAATAATCTGCTTCAGGGTCCAATTCCTCTGTTTAAAACAGGGGTTGTTGTGGATATGACTAATGATTCCAACAGTTTTTGTTTGCAAGATCCTGGGGAATGTGATTCACGAGTGAATACATTGCTTTCTATTGTGAAATTTATGGGTTATCCTCAAAGATTTGCGGAGAATTGGAAGGGAAATGATCCGTGTGCTGAGTGGATTGGAATTTCTTGCAGGAATCAAAGCATAACCATCGTAAACTTTCAGAAAATGGGACTTTCTGGTATGATTTCTCCTGAGTTTGCATCTCTTAAAGGGCTGGAAAGATTGGTTCTTGCTGATAATCATCTCACAGGCTCTATTCCTGAGGAGCTTACAACTCTTCCTTTTCTAACTGAGTTGGATGTTTCGAATAATCAGCTTTCTGGGAAGATTCCTAAGTTTAGGAGTAATGTAATGATGACCATCACAGGTAACCCTGATATTGGGAAAGAAAAAACTGATTCTTCTTCTAATGGTGCTTCACCGTCAGCGAGTTCGAATGACACGAAGGAAGCAGGGTCTAATGGTGGTGGAAATTCCGGAGATGGGGAGAAGAAACCTAGTTCCATGGTTGGAGTCATTGTTCTTTCTGTTGTTGGTGGTGTCTTTGTTCTGTTCTTGATTGGATTGGTGGTTTTGTGTGTGTATAAAATGAAGCAGAAACGATTTAGTCAGGTGCAAAGCCCAAACGCTATGGTTATTCATCCACGCCATTCGGGTTCCGATAATGAGAGTGTAAAGATCACAGTTGCCGGATCGAGTGTTAGGGTTGGTGCAATTAGTGAAACACAAAATGGTGCTAGCAGTGAGACTGGTGATATTCAAATGGTTGAAGCTGGGAACATGGTGATTTCAATTCAGGTGTTGAAAAATGTCACCAATAATTTCAGTGAAGAGAACATTTTGGGACAGGGAGGGTTTGGAACCGTTTACAAAGGAGAGTTGCACGACGGGACAAAGATTGCAGTGAAGAGAATGGAATCAGGAGTCATTAAAGGCAAGGGACTAACAGAGTTCAAGTCTGAGATCGCTGTTTTGACAAAAGTTCGGCACCGACATCTCGTCGCTCTTCTCGGATACTGCTTAGATGGGAACGAGAAACTTCTCGTTTACGAGTACATGCCTCAAGGTACTCTTAGCAGACATCTTTTCAACTGGCCAGAAGAAGGATTGAAACCTTTGGAATGGACAAAGAGGCTGACCATTGCATTAGATGTTGCAAGGGGTGTTGAGTATCTTCATGGTTTGGCACATCAAAGCTTTATACATAGGGATTTGAAGCCTTCAAACATTCTTCTTGGAGATGATATGAGAGCTAAGGTTGCAGACTTTGGTCTTGTCCGTCTAGCACCAGAAGGTAAGGGTTCCATTGAGACGAGGATTGCTGGGACCTTTGGATATTTGGCACCAGAGTATGCAGTTACGGGTCGCGTAACGACTAAAGTTGATGTATTCAGCTTCGGTGTGATTCTAATGGAGCTAATCACCGGGAGAAAGGCTCTTGACGAGAGCCAGCCTGAGGAAAGCATGCACCTTGTAACTTGGTTCCGTCGGATGCAAATCAACAAGGACTCCTTTCACAAGGCTATTGATCCAACCATTGATCTTACCGAAGAAACGTTTGCCAGCATCAACACCGTGGCGGAGTTGGCTGGTCATTGTTGTGCTAGGGAGCCATATCAAAGACCAGATATGGGTCATGCAGTAAACGTACTATCATCTCTTGTTGAGTTTTGGAAACCAACTGACCAGAACTCCGAAGATATATATGGCATTGACCTTGAGATGTCATTGCCTCAAGCTCTCAAGAAATGGCAGGCTTATGAAGGTAGAAGTCAAATGGAATCGTCTTCATCGTCCCTCCTTCCAAGCTTCGACAACACTCAGACCAGCATACCAACAAGGCCTTACGGGTTTGCAGAATCTTTCACATCTGCAGATGGGAGATGA


Protein sequences

Name Description Sequence
Cucsa.001360.1 transmembrane kinase 1 (best arabidopsis hit)

MEKKKTHFVNKHFLILAIFSIFHSVEPQELSPDAPAMTALKKSLNPTESLGWSDPNPCKWNHVLCSDDNRVTRIQIGRQNLQGMLPLNLQNLTALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDENPFSAWEIPASLRNASTLQNFSANSANVTGRIPEFLGGEDIPGLTNLHLAFNNLEGGLPSSFSGSQLESLWVNGQNSADKLSGSIDVLQNMTSLIEVWLHSNSFSGPLPDFSRLKDLQALSLRDNKFTGPVPSSLVNSPSLKVVNLTNNLLQGPIPLFKTGVVVDMTNDSNSFCLQDPGECDSRVNTLLSIVKFMGYPQRFAENWKGNDPCAEWIGISCRNQSITIVNFQKMGLSGMISPEFASLKGLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLSGKIPKFRSNVMMTITGNPDIGKEKTDSSSNGASPSASSNDTKEAGSNGGGNSGDGEKKPSSMVGVIVLSVVGGVFVLFLIGLVVLCVYKMKQKRFSQVQSPNAMVIHPRHSGSDNESVKITVAGSSVRVGAISETQNGASSETGDIQMVEAGNMVISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSLVEFWKPTDQNSEDIYGIDLEMSLPQALKKWQAYEGRSQMESSSSSLLPSFDNTQTSIPTRPYGFAESFTSADGR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF467
13-940 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FLILAIFSIFHSVEPQELSPDAPAMTALKKSLNPTESLGWSDPNPCKWNHVLCSDDNRVTRIQIGRQNLQGMLPLNLQNLTALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDENPFSAWEIPASLRNASTLQNFSANSANVTGRIPEFLGGEDIPGLTNLHLAFNNLEGGLPSSFSGSQLESLWVNGQNSADKLSGSIDVLQNMTSLIEVWLHSNSFSGPLPDFSRLKDLQALSLRDNKFTGPVPSSLVNSPSLKVVNLTNNLLQGPIPLFKTGVVVDMTNDSNSFCLQDPGECDSRVNTLLSIVKFMGYPQRFAENWKGNDPCAEWIGISCRNQSITIVNFQKMGLSGMISPEFASLKGLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLSGKIPKFRSNVMMTITGNPDIGKEKTDSSSNGASPSASSNDTKEAGSNGGGNSGDGEKKPSSMVGVIVLSVVGGVFVLFLIGLVVLCVYKMKQKRFSQVQSPNAMVIHPRHSGSDNESVKITVAGSSVRVGAISETQNGASSETGDIQMVEAGNMVISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSLVEFWKPTDQNSEDIYGIDLEMSLPQALKKWQAYEGRSQMESSSSSLLPSFDNTQTSIPTRP

HMMPanther: PTHR24420
13-940 FAMILY NOT NAMED,FAMILY NOT NAMED

FLILAIFSIFHSVEPQELSPDAPAMTALKKSLNPTESLGWSDPNPCKWNHVLCSDDNRVTRIQIGRQNLQGMLPLNLQNLTALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDENPFSAWEIPASLRNASTLQNFSANSANVTGRIPEFLGGEDIPGLTNLHLAFNNLEGGLPSSFSGSQLESLWVNGQNSADKLSGSIDVLQNMTSLIEVWLHSNSFSGPLPDFSRLKDLQALSLRDNKFTGPVPSSLVNSPSLKVVNLTNNLLQGPIPLFKTGVVVDMTNDSNSFCLQDPGECDSRVNTLLSIVKFMGYPQRFAENWKGNDPCAEWIGISCRNQSITIVNFQKMGLSGMISPEFASLKGLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLSGKIPKFRSNVMMTITGNPDIGKEKTDSSSNGASPSASSNDTKEAGSNGGGNSGDGEKKPSSMVGVIVLSVVGGVFVLFLIGLVVLCVYKMKQKRFSQVQSPNAMVIHPRHSGSDNESVKITVAGSSVRVGAISETQNGASSETGDIQMVEAGNMVISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSLVEFWKPTDQNSEDIYGIDLEMSLPQALKKWQAYEGRSQMESSSSSLLPSFDNTQTSIPTRP

superfamily: SSF52058
26-446 L domain-like,LRR

EPQELSPDAPAMTALKKSLNPTESLGWSDPNPCKWNHVLCSDDNRVTRIQIGRQNLQGMLPLNLQNLTALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDENPFSAWEIPASLRNASTLQNFSANSANVTGRIPEFLGGEDIPGLTNLHLAFNNLEGGLPSSFSGSQLESLWVNGQNSADKLSGSIDVLQNMTSLIEVWLHSNSFSGPLPDFSRLKDLQALSLRDNKFTGPVPSSLVNSPSLKVVNLTNNLLQGPIPLFKTGVVVDMTNDSNSFCLQDPGECDSRVNTLLSIVKFMGYPQRFAENWKGNDPCAEWIGISCRNQSITIVNFQKMGLSGMISPEFASLKGLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLSGKIPKFRSNVMMTI

HMMPfam: PF08263
IPR013210
32-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDAPAMTALKKSLNPTESLGWSDPNPCKWNHVLCS

Gene3D: G3DSA:3.80.10.10
39-308 no description

ALKKSLNPTESLGWSDPNPCKWNHVLCSDDNRVTRIQIGRQNLQGMLPLNLQNLTALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDENPFSAWEIPASLRNASTLQNFSANSANVTGRIPEFLGGEDIPGLTNLHLAFNNLEGGLPSSFSGSQLESLWVNGQNSADKLSGSIDVLQNMTSLIEVWLHSNSFSGPLPDFSRLKDLQALSLRDNKFTGPVPSSLVNSPSLKVVNLTNNLLQGPIPLFK

HMMSmart: SM00369
IPR003591
92-114 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTALERLELQWNKISGPLPSLSG

ProfileScan: PS51450
IPR001611
94-116 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALERLELQWNKISGPLPSLSGLT

Seg: seg
106-124 seg

SGPLPSLSGLTSLQVLLLS

HMMPfam: PF13855
111-151 LRR_8,Leucine rich repeat

SLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDENP

HMMSmart: SM00369
IPR003591
115-138 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLQVLLLSGNQFTSIPSDFFAG

ProfileScan: PS51450
IPR001611
117-138 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQVLLLSGNQFTSIPSDFFAG

HMMSmart: SM00369
IPR003591
190-213 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IPGLTNLHLAFNNLEGGLPSSFSG

ProfileScan: PS51450
IPR001611
192-213 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTNLHLAFNNLEGGLPSSFSG

ProfileScan: PS51450
IPR001611
242-264 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIEVWLHSNSFSGPLPDFSRLK

ProfileScan: PS51450
IPR001611
265-286 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLQALSLRDNKFTGPVPSSLVN

Seg: seg
279-295 seg

PVPSSLVNSPSLKVVNL

ProfileScan: PS51450
IPR001611
289-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKVVNLTNNLLQGPIPLFKTG

HMMPfam: PF08263
IPR013210
334-368 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

VNTLLSIVKFMGYPQRFAENWKGNDPCAEWIGISC

Gene3D: G3DSA:3.80.10.10
345-438 no description

GYPQRFAENWKGNDPCAEWIGISCRNQSITIVNFQKMGLSGMISPEFASLKGLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLSGKIPKF

HMMSmart: SM00369
IPR003591
394-418 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKGLERLVLADNHLTGSIPEELTTL

ProfileScan: PS51450
IPR001611
396-419 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLERLVLADNHLTGSIPEELTTLP

HMMPfam: PF12799
396-432 LRR_4,Leucine Rich repeats (2 copies)

GLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLS

Seg: seg
412-424 seg

PEELTTLPFLTEL

ProfileScan: PS51450
IPR001611
420-442 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLTELDVSNNQLSGKIPKFRSNV

Seg: seg
459-471 seg

SSSNGASPSASSN

Seg: seg
477-487 seg

GSNGGGNSGDG

Seg: seg
495-517 seg

VGVIVLSVVGGVFVLFLIGLVVL

superfamily: SSF56112
IPR011009
572-899 Protein kinase-like (PK-like)
Protein kinase-like domain

SSETGDIQMVEAGNMVISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSLVEFWKPTDQNSEDIYGIDLE

Gene3D: G3DSA:2.60.120.200
IPR013320
576-620 no description
Concanavalin A-like lectin/glucanase, subgroup

GDIQMVEAGNMVISIQVLKNVTNNFSEENILGQGGFGTVYKGELH

HMMSmart: SM00219
IPR020635
600-876 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVL

HMMSmart: SM00220
IPR002290
600-880 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSLV

ProfileScan: PS50011
IPR000719
600-880 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSLV

HMMPfam: PF00069
IPR000719
602-874 Pkinase,Ser-thr
Protein kinase, catalytic domain

EENILGQGGFGTVYKGELHDGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVN

PatternScan: PS00107
IPR017441
606-628 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGTVYKGELHDGTKIAVK

Gene3D: G3DSA:3.30.200.20
621-670 no description

DGTKIAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNE

Gene3D: G3DSA:1.10.510.10
671-874 no description

KLLVYEYMPQGTLSRHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTWFRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVN

PatternScan: PS00108
IPR008271
725-737 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL

Seg: seg
920-928 seg

SSSSSLLPS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox