PRGDB00150850 (Cucsa.001610.1)

From PRG Wiki
Revision as of 03:47, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Cucsa.001610.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type NBS
Gene Species Pennisetum glaucum

Comment?

Flavin-binding monooxygenase family protein (best arabidopsis hit)

DNA Sequence

ATGGACGATTATTGGAAAGAATTGCAAGGCAAAAGACTTCACGATCCTCTCACCAAAAATCAAGTCAGCCCAATTCCACAAATTTTGGTTCAAGGGCCTCTCATCGTTGGTGCCGGACCGTCGGGCTTAGCGGTCGCAGCATGTCTAAAGCAAAAGGGTATCCAAAGTTTGATCCTTGAAAGAGCCGAATGTATAGCTTCATTATGGCAGTTCAAGACATATGACCGTCTTCGCTTGCATCTTCCAAAGCCATTTTGTCAGCTCCCATTCATGCCTTTCCCTTCACATTTCCCCACTTACCCAACAAAGCAACAATTTTTAAGCTATTTGAAAGCCTATGCTGATTATTTTAAGTTGAAGACGGTGTTTAATAGCACAGTTATAAGGGCAGAGTGGGATGAGAGATGTGGGTTTTGGAAAGTGAAATCAGTTAAAGACCAAAAGGTTATTGTTGAGTATTTTTGTAAGTGGTTGATTGTGGCAACGGGTGAAAATGCTGAAGAGATTATTCCTCAAATTGAAGGGTTAGAGATATTTGAAGGCCCTGTTGTTCATACTAGCTCTTATAAGACAGGTGAAGTGTTTCATGGGAAGAAAGTTTTGGTTATTGGTTGTGGTAATTCTGGAATGGAAGTTTGTCTTGATTTATGTAACTTCAACGCGTCCCCTCACCTCGTCGTGCACATTCTACCTCATGAGATATTGGGAAGATCAACATTTGGGTTGTCCATGTGCTTGCTCAGATGGCTTCCCATGCGTATAGTGGATCAATTTCTTCTTCTTGTTTCACGTTTGATGTTAGGAGATACATCTAAATTGGGGCTTCATCGTCCAAAACTTGGCCCTTTACAGCTCAAGAATCTGTCTGGAAAAACGCCTGTTTTAGATGTTGGCACTTTTGCAAAAATCAAAACCGGCAAGATTAAGGTTCGTCGAGGAGTGACAAGACTAACCCGCCATGCCGCTGAGTTCGTTGATGGCAGCCTCGAAAATTTTGATGCTGTCATTTTGGCCACTGGTTATAAAAGTAATGTACCCTCTTGGCTAAAGGAAAGGCATATGTTTGATGAGAAAGATGGAATGCCAAGGAAGGAATTTCCAAATGGATGGAAAGGTGAATGTGGACTATATGCAGTTGGGTTCACAAAGAGAGGGCTACTTGGAGCTTCAATGGATGCAAAAAGAATAGCTGAAGATATTGAACTTTGTTTGGAAAATTAA


Protein sequences

Name Description Sequence
Cucsa.001610.1 Flavin-binding monooxygenase family protein (best arabidopsis hit)

MDDYWKELQGKRLHDPLTKNQVSPIPQILVQGPLIVGAGPSGLAVAACLKQKGIQSLILERAECIASLWQFKTYDRLRLHLPKPFCQLPFMPFPSHFPTYPTKQQFLSYLKAYADYFKLKTVFNSTVIRAEWDERCGFWKVKSVKDQKVIVEYFCKWLIVATGENAEEIIPQIEGLEIFEGPVVHTSSYKTGEVFHGKKVLVIGCGNSGMEVCLDLCNFNASPHLVVHILPHEILGRSTFGLSMCLLRWLPMRIVDQFLLLVSRLMLGDTSKLGLHRPKLGPLQLKNLSGKTPVLDVGTFAKIKTGKIKVRRGVTRLTRHAAEFVDGSLENFDAVILATGYKSNVPSWLKERHMFDEKDGMPRKEFPNGWKGECGLYAVGFTKRGLLGASMDAKRIAEDIELCLEN*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
27-401 MONOOXYGENASE,MONOOXYGENASE

QILVQGPLIVGAGPSGLAVAACLKQKGIQSLILERAECIASLWQFKTYDRLRLHLPKPFCQLPFMPFPSHFPTYPTKQQFLSYLKAYADYFKLKTVFNSTVIRAEWDERCGFWKVKSVKDQKVIVEYFCKWLIVATGENAEEIIPQIEGLEIFEGPVVHTSSYKTGEVFHGKKVLVIGCGNSGMEVCLDLCNFNASPHLVVHILPHEILGRSTFGLSMCLLRWLPMRIVDQFLLLVSRLMLGDTSKLGLHRPKLGPLQLKNLSGKTPVLDVGTFAKIKTGKIKVRRGVTRLTRHAAEFVDGSLENFDAVILATGYKSNVPSWLKERHMFDEKDGMPRKEFPNGWKGECGLYAVGFTKRGLLGASMDAKRIAEDIE

HMMPanther: PTHR23023
27-401 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

QILVQGPLIVGAGPSGLAVAACLKQKGIQSLILERAECIASLWQFKTYDRLRLHLPKPFCQLPFMPFPSHFPTYPTKQQFLSYLKAYADYFKLKTVFNSTVIRAEWDERCGFWKVKSVKDQKVIVEYFCKWLIVATGENAEEIIPQIEGLEIFEGPVVHTSSYKTGEVFHGKKVLVIGCGNSGMEVCLDLCNFNASPHLVVHILPHEILGRSTFGLSMCLLRWLPMRIVDQFLLLVSRLMLGDTSKLGLHRPKLGPLQLKNLSGKTPVLDVGTFAKIKTGKIKVRRGVTRLTRHAAEFVDGSLENFDAVILATGYKSNVPSWLKERHMFDEKDGMPRKEFPNGWKGECGLYAVGFTKRGLLGASMDAKRIAEDIE

FPrintScan: PR00469
IPR000103
32-54 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPLIVGAGPSGLAVAACLKQKGI

FPrintScan: PR00368
IPR013027
33-52 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PLIVGAGPSGLAVAACLKQK

superfamily: SSF51905
34-311 FAD/NAD(P)-binding domain

LIVGAGPSGLAVAACLKQKGIQSLILERAECIASLWQFKTYDRLRLHLPKPFCQLPFMPFPSHFPTYPTKQQFLSYLKAYADYFKLKTVFNSTVIRAEWDERCGFWKVKSVKDQKVIVEYFCKWLIVATGENAEEIIPQIEGLEIFEGPVVHTSSYKTGEVFHGKKVLVIGCGNSGMEVCLDLCNFNASPHLVVHILPHEILGRSTFGLSMCLLRWLPMRIVDQFLLLVSRLMLGDTSKLGLHRPKLGPLQLKNLSGKTPVLDVGTFAKIKTGKIKVR

Gene3D: G3DSA:3.50.50.60
35-212 no description

IVGAGPSGLAVAACLKQKGIQSLILERAECIASLWQFKTYDRLRLHLPKPFCQLPFMPFPSHFPTYPTKQQFLSYLKAYADYFKLKTVFNSTVIRAEWDERCGFWKVKSVKDQKVIVEYFCKWLIVATGENAEEIIPQIEGLEIFEGPVVHTSSYKTGEVFHGKKVLVIGCGNSGMEV

HMMPfam: PF00743
IPR020946
35-346 FMO-like
Flavin monooxygenase-like

IVGAGPSGLAVAACLKQKGIQSLILERAECIASLWQFKTYDRLRLHLPKPFCQLPFMPFPSHFPTYPTKQQFLSYLKAYADYFKLKTVFNSTVIRAEWDERCGFWKVKSVKDQKVIVEYFCKWLIVATGENAEEIIPQIEGLEIFEGPVVHTSSYKTGEVFHGKKVLVIGCGNSGMEVCLDLCNFNASPHLVVHILPHEILGRSTFGLSMCLLRWLPMRIVDQFLLLVSRLMLGDTSKLGLHRPKLGPLQLKNLSGKTPVLDVGTFAKIKTGKIKVRRGVTRLTRHAAEFVDGSLENFDAVILATGYKSNVP

FPrintScan: PR00368
IPR013027
155-173 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

CKWLIVATGENAEEIIPQI

FPrintScan: PR00469
IPR000103
195-219 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FHGKKVLVIGCGNSGMEVCLDLCNF

FPrintScan: PR00368
IPR013027
199-217 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

KVLVIGCGNSGMEVCLDLC

Gene3D: G3DSA:3.50.50.60
300-357 no description

FAKIKTGKIKVRRGVTRLTRHAAEFVDGSLENFDAVILATGYKSNVPSWLKERHMFDE

superfamily: SSF51905
304-402 FAD/NAD(P)-binding domain

KTGKIKVRRGVTRLTRHAAEFVDGSLENFDAVILATGYKSNVPSWLKERHMFDEKDGMPRKEFPNGWKGECGLYAVGFTKRGLLGASMDAKRIAEDIEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox