PRGDB00150863 (Cucsa.009200.2)

From PRG Wiki
Revision as of 03:47, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Cucsa.009200.2
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGACTGAGGCTAAATTGTTGGCTCGAGTGCAGCACAGAAATGTCGTCAATTTGTTGGGATACTGTGTGCATGGTGCAGAGAAACTACTGGTTTACGAATACGTCATGAATGAGAGCCTCGACAAGCTTCTCTTTACAGAATCCAGCAGACGAGGAGAACTTGATTGGAAGAGGAGATATGACATAATCTTTGGCGTAGCACGAGGGTTGCAATATCTTCATGTAGACTCACATAACGTCATTATCCATCGTGACATAAAGGCTAGTAACATTTTGTTGGATGACAAATGGGTTCCTAAAATTGCGGATTTTGGCATGGCTCGTCTCTTCCCTGAAGATCAAACTCATGTCAATACTCGAGTTGCTGGTACAAATGGATATATGGCTCCCGAATATGTAATGCACGGGCATCTATCAGTAAAGGCAGACGTTTTTAGCTTTGGAGTTTTGGTTTTGGAACTTATAAGTGGCCAGCGAAATTCGTCATTTACTTCATTTATGGATGCGGAGAATCTACTTGATTGGGCTTACAAACTGTACAAGAAGGGAAGAAGCTTGGAGATCATGGACCCAACATTAGCATCATCAGCTGTTCCTGACCAAGTTACAATGTGCATTCAAATAGGATTGCTCTGCACACAAGGTGATTCACACCTACGGCCGACCATGCCACGTGTAGTTTTAATTCTTTCAAAGAGACCTGGTAATTTGGAGGAACCAACGAGACCGGGAATGCCCGGTTCTCGGTATAGAAGAACTCGTAGGACAAGTGCATCGTCCTCCATTGTGGGTACTTCGGGAACTTCGTCTGGTGTATCCGACTCCTATGCTTTGACAACCAATACTACTGGAACTATAACTGCTACGGCGACCGCAACCGCAACTGCAAATGAAGTTGCTTCTAGCTCTTCTCCAATTAGTCGAAGATACGATACTCGTGGGAAACGTCCAATAGAAGGTTAG


Protein sequences

Name Description Sequence
Cucsa.009200.2 Protein kinase superfamily protein (best arabidopsis hit)

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLEEPTRPGMPGSRYRRTRRTSASSSIVGTSGTSSGVSDSYALTTNTTGTITATATATATANEVASSSSPISRRYDTRGKRPIEG*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
1-35 no description

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYV

HMMSmart: SM00220
IPR002290
1-229 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLI

superfamily: SSF56112
IPR011009
1-238 Protein kinase-like (PK-like)
Protein kinase-like domain

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLE

HMMPanther: PTHR24420
1-314 FAMILY NOT NAMED,FAMILY NOT NAMED

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLEEPTRPGMPGSRYRRTRRTSASSSIVGTSGTSSGVSDSYALTTNTTGTITATATATATANEVASSSSPISRRYDTRG

HMMPanther: PTHR24420:SF787
1-314 SUBFAMILY NOT NAMED

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLEEPTRPGMPGSRYRRTRRTSASSSIVGTSGTSSGVSDSYALTTNTTGTITATATATATANEVASSSSPISRRYDTRG

HMMSmart: SM00219
IPR020635
1-230 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLIL

ProfileScan: PS50011
IPR000719
1-236 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGN

HMMPfam: PF00069
IPR000719
3-164 Pkinase,Ser-thr
Protein kinase, catalytic domain

EAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFT

Gene3D: G3DSA:1.10.510.10
38-227 no description

ESLDKLLFTESSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVV

PatternScan: PS00108
IPR008271
81-93 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL

Seg: seg
248-275 seg

SRYRRTRRTSASSSIVGTSGTSSGVSDS

Seg: seg
277-296 seg

ALTTNTTGTITATATATATA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox