PRGDB00150869 (Cucsa.010860.1)

From PRG Wiki
Revision as of 03:47, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Cucsa.010860.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGGGGTCCTGCCTTAGTGCTAGAATTAAAGCTGAGAGCCCTCTTCACAACGGGTTGAGCTCCAGGTATGCAAGAGATGGAAATGATAAAGGGAATTCAACCAGCAAGTCATCTGTCTCGACCCCTCGGACCCCTCGAACGGAGGGCGAGATCTTGCAGTCCTCCAACTTGAAAAACTTCTCCTACAATGAGCTTAAAGCTGCCACCCGAAACTTCCGTCCTGATAGTGTATTGGGTGAGGGTGGATTTGGTTCTGTATTTAAGGGGTGGATTGATGAACAGTCCTTTGCAGTTACGAAGCCCGGGACTGGCTTAGTCATTGCAGTAAAAAGGCTCAACCAGGAAGGTTTCCAGGGTCATAGAGAATGGCTGACAGAAATTGACTATCTAGGCCAGCTGCATCATCCTAATCTTGTGAGATTGATTGGCTTTTGCTTAGAGGATGAGCATCGACTTCTTGTATATGAATTTATGCCTCGTGGCAGCTTGGAAAATCATCTATTTAGGAGGAGTTCTCACTTTCAACCTCTATCATGGAGTCTCCGATTGAAAGTTGCTCTTGGTGCTGCTAAAGGTCTAGCTTTTCTACATAGCGATGAAGCGAAAGTAATATACCGGGACTTTAAAAGCTCTAATATCTTGCTGGATTCGGACTATAATGCAAAACTCTCTGATTTTGGATTAGCCAAAGATGGGCCTACAGGTGACAGAAGCTATGTTTCTACAAGGGTAATGGGAACATTTGGCTATGCAGCTCCTGAATATATGATCACAGGTCATCTCACAGCCAAGAGTGATGTGTATAGCTTTGGAGTTGTTCTTCTCGAGATCCTATCAGGGAGACGAGCTATAGACAAAAACCGACCATCTGGAGAACACAACCTTGTGGAATGGGCAAAACCTTACCTCACTAGCAAACGAAGAGTACTTCAAATGTTGGACGCACGAATTGAAGGCCAATATTCGACCGGAGGAGCACTAAAAGCGGCTAAACTTGCCATTCAATGTATATCGACAGAACCTAAGTTAAGACCGAACATGAATGCAGTCGTGAAAGCATTGGAACAACTTCAGGATTCGAGTGAAACGAGTGGATCAAGGGGAACTTTAAGCGAACCCTTGAACACATCCAGCCAAGGCAGTGGCTCCACAAATAACAAACCTGTTTCTTATCCTAGACCATCAGCTTCAGTACTAAATCTATAG


Protein sequences

Name Description Sequence
Cucsa.010860.1 Protein kinase superfamily protein (best arabidopsis hit)

MGSCLSARIKAESPLHNGLSSRYARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLKNFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQLQDSSETSGSRGTLSEPLNTSSQGSGSTNNKPVSYPRPSASVLNL*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF861
42-364 SUBFAMILY NOT NAMED

PRTPRTEGEILQSSNLKNFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQLQDSSETS

HMMPanther: PTHR24420
42-364 FAMILY NOT NAMED,FAMILY NOT NAMED

PRTPRTEGEILQSSNLKNFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQLQDSSETS

superfamily: SSF56112
IPR011009
44-377 Protein kinase-like (PK-like)
Protein kinase-like domain

TPRTEGEILQSSNLKNFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQLQDSSETSGSRGTLSEPLNTS

Gene3D: G3DSA:3.30.200.20
53-144 no description

QSSNLKNFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGF

ProfileScan: PS50011
IPR000719
72-357 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQL

HMMSmart: SM00219
IPR020635
72-354 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKAL

HMMSmart: SM00220
IPR002290
72-357 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQL

HMMPfam: PF07714
IPR001245
76-354 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEGFQGHREWLTEIDYLGQLHHPNLVRLIGFCLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKAL

PatternScan: PS00107
IPR017441
78-110 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVK

Gene3D: G3DSA:1.10.510.10
145-358 no description

CLEDEHRLLVYEFMPRGSLENHLFRRSSHFQPLSWSLRLKVALGAAKGLAFLHSDEAKVIYRDFKSSNILLDSDYNAKLSDFGLAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQLQ

Seg: seg
181-194 seg

LRLKVALGAAKGLA

PatternScan: PS00108
IPR008271
203-215 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKSSNILL

Seg: seg
375-386 seg

NTSSQGSGSTNN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox