PRGDB00160334 (Egrandis_v1_0.022539m)

From PRG Wiki
Revision as of 10:19, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Egrandis_v1_0.022539m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class T
Domain Type TIR, LRR
Gene Species Areca catechu

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGAAGCCCTACCAACCCGCTACAACGTGTTCTTGAGTTTCAGAGGCGCAGACGATCGCACCGGCTTCGTCTATCACCTCTACAAGAGGCTGCTGGATTCTGGGGTCCACGTGTCACGCAACGATTGCGCGCTCCCGGTCCACAAGGAGAAAGGCACGGAGCAGCTTGTCTGGGCCATCAGTAGATGTAAAATCGCGATACCCATCATCTCCCGAGGGTATGCGAGTAGTACATGGTGCCTTGAGGAGCTCGCCGCGATCATGGATTGCCGCAGAAGGGATGACAAATTGGTCTTCCCTGTATTCTATAATGTGGATGTTGTTGATTTGGGTCGCCGACGCGGTGACTTTGATGATGAGATGAAGTGCAGTTCGGAAGAAGTGCTGAAATGGCAGGAAGCGCTGACTTCTGTAGCGAGGATTAGAGGGTGGATATCACAGAGCACTGCTGATGGGATTAGGTATTTACCGGTTCTATTTCAGCCAATCTTCGGCATTTTCGTAGTGGCTACATCTTATCATCTTATCGTATCGCTTTGGTTTGTCTCGCTGAATCGCAGCTTATCTTTTGTTTTTGGAGAAGAAAAGAAGAGAACTAAATGCCAAGTGTTCTTGGCCTTTCGTGGCCCCGATACTCGATACAACCTTGCTGACTACCTCTACGTCAGCCTCATGGCATCAGGAATTGGAGTGTTTAATCATGATGATCCCACACTCATAGGTAAAGATTTTAGTAATGAGATTAGCAATGCCATCAACCGCTGCGAGATATCCATTCCGATTCTCTCTTCGAATTATTTCTCCTCGCCTTGGTGCCTGGAAGAGCTCGCTTGA


Protein sequences

Name Description Sequence
Egrandis_v1_0.022539m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MEALPTRYNVFLSFRGADDRTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEALTSVARIRGWISQSTADGIRYLPVLFQPIFGIFVVATSYHLIVSLWFVSLNRSLSFVFGEEKKRTKCQVFLAFRGPDTRYNLADYLYVSLMASGIGVFNHDDPTLIGKDFSNEISNAINRCEISIPILSSNYFSSPWCLEELA*

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-144 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

PTRYNVFLSFRGADDRTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEALTSVARIRGW

ProfileScan: PS50104
IPR000157
6-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TRYNVFLSFRGADDRTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEALTSVARIRGW

Gene3D: G3DSA:3.40.50.10140
6-133 no description

TRYNVFLSFRGADDRTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQE

HMMSmart: SM00255
IPR000157
7-141 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RYNVFLSFRGADDRTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEALTSVARI

HMMPfam: PF01582
IPR000157
10-135 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGADDRTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEAL

HMMPanther: PTHR23155:SF252
20-143 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEALTSVARIRG

HMMPanther: PTHR23155
20-143 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RTGFVYHLYKRLLDSGVHVSRNDCALPVHKEKGTEQLVWAISRCKIAIPIISRGYASSTWCLEELAAIMDCRRRDDKLVFPVFYNVDVVDLGRRRGDFDDEMKCSSEEVLKWQEALTSVARIRG

superfamily: SSF52200
IPR000157
189-276 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

SFVFGEEKKRTKCQVFLAFRGPDTRYNLADYLYVSLMASGIGVFNHDDPTLIGKDFSNEISNAINRCEISIPILSSNYFSSPWCLEEL

Gene3D: G3DSA:3.40.50.10140
197-276 no description

KRTKCQVFLAFRGPDTRYNLADYLYVSLMASGIGVFNHDDPTLIGKDFSNEISNAINRCEISIPILSSNYFSSPWCLEEL

ProfileScan: PS50104
IPR000157
199-277 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TKCQVFLAFRGPDTRYNLADYLYVSLMASGIGVFNHDDPTLIGKDFSNEISNAINRCEISIPILSSNYFSSPWCLEELA

HMMPfam: PF01582
IPR000157
203-276 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLAFRGPDTRYNLADYLYVSLMASGIGVFNHDDPTLIGKDFSNEISNAINRCEISIPILSSNYFSSPWCLEEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox