PRGDB00160342 (Egrandis_v1_0.042180m)

From PRG Wiki
Revision as of 10:18, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Egrandis_v1_0.042180m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class T
Domain Type TIR, LRR
Gene Species Areca catechu

Comment?

transmembrane receptors;ATP binding (best arabidopsis hit)

DNA Sequence

TTGCCTATAACTGATGTGTTCCTGAGTTTTAAGGGACCAGACACTCATCATAGTATTGTCAGTTATCTTCACTCTCGGATGCTTTGGAATCAAATGTCTGTTTATAGTGATAATGATGACTTGAGGTCCAATGAAGAGACTGGGGAAAAGATTCTAGGGTTACTCGCTAACTCTAATATCTACATACCCATCTTCTCTAGGAACTATGTTTCTGGTCATTGGTGTCTCCGCGTACTTGCTTACATGGTAAAATGCACGTTAGAATCAAAGGGGAAAAGAAGAATCCTCCCCATTTTCTACGATGTGGAGATTGATGATGTTAAGCTCAAAACTGATTTATACAAAAGCGACCTAGACAAGCACCAAGCGAACTTCGACCACGATGAAGTGAAGTCATGGAAAGAGGCCCTCATTAAGGTCGCAGCATTGAGGGGTTTCATCTTGAAAAACAAC


Protein sequences

Name Description Sequence
Egrandis_v1_0.042180m transmembrane receptors;ATP binding (best arabidopsis hit)

LPITDVFLSFKGPDTHHSIVSYLHSRMLWNQMSVYSDNDDLRSNEETGEKILGLLANSNIYIPIFSRNYVSGHWCLRVLAYMVKCTLESKGKRRILPIFYDVEIDDVKLKTDLYKSDLDKHQANFDHDEVKSWKEALIKVAALRGFILKNN

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
2-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PITDVFLSFKGPDTHHSIVSYLHSRMLWNQMSVYSDNDDLRSNEETGEKILGLLANSNIYIPIFSRNYVSGHWCLRVLAYMVKCTLESKGKRRILPIFYDVEIDDVKLKTDLYKSDLDKHQANFDHDEVKSWKEALIKVAAL

HMMSmart: SM00255
IPR000157
3-143 Toll
Toll/interleukin-1 receptor homology (TIR) domain

ITDVFLSFKGPDTHHSIVSYLHSRMLWNQMSVYSDNDDLRSNEETGEKILGLLANSNIYIPIFSRNYVSGHWCLRVLAYMVKCTLESKGKRRILPIFYDVEIDDVKLKTDLYKSDLDKHQANFDHDEVKSWKEALIKVAAL

Gene3D: G3DSA:3.40.50.10140
5-140 no description

DVFLSFKGPDTHHSIVSYLHSRMLWNQMSVYSDNDDLRSNEETGEKILGLLANSNIYIPIFSRNYVSGHWCLRVLAYMVKCTLESKGKRRILPIFYDVEIDDVKLKTDLYKSDLDKHQANFDHDEVKSWKEALIKV

superfamily: SSF52200
IPR000157
5-146 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

DVFLSFKGPDTHHSIVSYLHSRMLWNQMSVYSDNDDLRSNEETGEKILGLLANSNIYIPIFSRNYVSGHWCLRVLAYMVKCTLESKGKRRILPIFYDVEIDDVKLKTDLYKSDLDKHQANFDHDEVKSWKEALIKVAALRGF

HMMPfam: PF01582
IPR000157
6-137 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFKGPDTHHSIVSYLHSRMLWNQMSVYSDNDDLRSNEETGEKILGLLANSNIYIPIFSRNYVSGHWCLRVLAYMVKCTLESKGKRRILPIFYDVEIDDVKLKTDLYKSDLDKHQANFDHDEVKSWKEAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox