PRGDB00172358 (ppa000241m)

From PRG Wiki
Revision as of 03:32, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa000241m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Prunus persica

Comment?

mitogen-activated protein kinase kinase kinase 7 (best arabidopsis hit)

DNA Sequence

ATGTCTAGGCAAGCGGGGTCGTCCCACTTTCACAAATCCAAGACTCTCGATAACAAATATATGCTTGGAGATGAGATTGGAAAGGGAGCATATGGTCGAGTTTACAAGGGGTTGGATTTGGAGAATGGAGACTTTGTCGCTATTAAACAAGTTTCTTTGGAGAATATTGCTCAGGAGGATCTCAACATTATAATGCAAGAGATTGATTTGCTCAAGAACTTAAACCACAAAAACATTGTGAAGTACCTTGGATCCTTAAAGACAAAGACTCATCTTCACATAGTCCTAGAGTATGTGGAGAATGGCTCACTTGCAAACATTATCAAGCCAAATAAGTTTGGACCTTTTCCAGAATCTTTGGTAGCTGTGTACATTGCTCAGGTTTTGGAGGGGTTGGTGTATTTACATGAACAGGGTGTAATCCATCGGGATATCAAGGGTGCAAATATTTTGACAACTAAAGAGGGGCTTGTGAAACTTGCTGATTTTGGTGTTGCGACAAAACTGACTGAGGCGGATGTCAATACACATTCGGTTGTTGGAACGCCATATTGGATGGCCCCAGAGGTGATTGAAATGTCGGGGGTTTGTGCCGCTTCGGACATTTGGAGTGTTGGCTGCACTGTTATTGAACTTCTTACTTGTGTACCTCCTTACTATGATCTACAGCCCATGCCAGCACTGTTTCGTATTGTTCAGGATGAGCATCCTCCCATACCTGACAGCTTATCTCATGATATTACTGATTTTTTGGGTCAGTGCTTTAAGAAGGATGCTAGGCACCGCCCTGATGCAAAGACATTGCTTTCTCACCCTTGGATACAAAACTGCCGGCGAGCTTTGCAATCTTCAATTCGTCATAGTGGAACACTAAGAAAAGATGCTTCAATTGATGCAGAAATTTCCAATGGTGATAATCAGGGCTCTGGTGAAAGTCCTGCAGAGAAAGTGGAAGTAGCTGCGTCCACCATTAAAACAGACTCTAAGAAAGAGTTATTATCAACTGAGGTTTCTGATATGAGCAAATCCGATGACGACCCTGCTTCAGTTCTAAAATTTTCTGAGGAGAAAACAGATGATTTAGAAGATGATGTGACGGATCAGGTTCCCACATTAGCTATCCATGAAAAGTCATCTTTTCAAAATGGTTCTGACAAAATACCTTCTAATAAGGAATTGGCTACCTCTGACCCAACTGAACTTGATGACCTACCACATAAGGGTAACCATGATGCAGTGCTGGCGAATGGTGAGGTTAGATCTCCTGAATCAATGACAAAAAACGTAAGTGGTAAACATGGAGGAAAAGGTGTTGGCTATAGATCATTCGGTTTTGGACAAAGAAATCAGGACGGTAGCTTTCAAAAGGCTGCCAAGATGCCAGTCCCTTTGGGAGGGAATGAACTCAGTAAATTTAGTGATACTCCAGGAGATGCTTCCTTGGATGATCTATTTCATCCATTGGATAAACATCCGGAGGATAAGGCAACTGAGGCTTCGACATCTGCATCTATGTCAATTTTGAACCAAGGAACTACATCTGCTAATGATGCTGGGAAAAGTGACCTGGCTACAAAGTTGAGAGCTACAATTGCTCAAAAACAAATGGAGAGCGAAATGGGTCAGGCAAACGGCAGTGGTGGCAACCTGTTACAGCTTATGATGGGTGTTCTCAAAGATGATGTGATTGATATTGGTGGTTTGGTTTTTGATGAAAAGTTGCCCGGAGAGAACCTTTTTCCCCTACAGGCTGTTGAGTTTAGCCGGTTGGTTGGGTCACTGAGACCAGATGAATCAGAAGATGTTATTGTTTCTGCCTGTCAGAAACTCATTGCTATCTTCCATCAGCGCCCAGAGCAGAAAAGTGTTTTTGTTACCCAGCATGGTTTGCTCCCTCTAATGGAATTGCTTGAAGTACCTAAAACCCGTGTTATATGCTCTGTGCTTCAAATTATAAATCAGATAATCAAAGATAATACTGATTTCCAGGAGAATGCTTGTCTTGTTGGTCTGATCCCAGTGGTAATGAGCTTTGCGGTTCCTAATCATTCTCGGGAAATTCGTATGGAAGCAGCTTATTTCTTACAGCAGCTTTGTCAGTCAAGCCCCTTGACATTGCAAATGTTTATAGCTTGCCGTGGAATACCTGTTCTGGTGGGCTTTTTAGAGGCTGATTATGCAAAATTCAGGGAAATGGTTCATCTAGCCATTGACGGGATGTGGCAAGTCTTTAAGCTTCAGAGATCAACTCCTAGAAATGATTTTTGTCGCATAGCTGCAAAGAATGGCATACTGCTCAGACTTATTAACACCCTTTATAGCTTGAATGAGGCAACTCGTCTAGCTTCTATATCTGGTGGGGGTGGATTTCCACATGATGGTTCAGCTCAGCGCGCACGGTCTGGTTCATTGGATTCTGGTCATCCAATTTTTGCTCAGAGTGACACACCACTTCCTACAACTGATCAGCATGATATGTCCAAGGCTAGGCATGGAATGATTGATTTTCATTTGTCAACTGGAACAGCAGAACCTGCACGTGCTTCAACTTCAAATTCCCAAAGGTTAGATGCCAATCAATCAGACCCCAGATATCTTCATCTAGATACGGATAGAGCGCAGTCTAGCAGTGTGGTAGTGGAAGCTTCCATTCCTTCTAAATTGCCAGACTCAACATCTGTAGATAAAGTTGTAAACATAACAACCAAAGAACGAGGAGATCTTGACCTCAGGCAGCAGCGAGCCACTAATTCTTCTAGTAGGGCATCCACAGATAGGCCTCCAAAAATGATGGAAGTTACATCAAATGGGTTTCCCACAACAGTAGCTGCTCAACAAGAGCAAGTCCGACCCCTTCTTAGTTTGTTAGAGAAAGAGCCTCCTTCCAGACACTTTTCTGGCCAGCTTGAGTATGTACGCCACCTACCAGGGTTGGAGAGACATGAAAGTATATTGCCCCTTTTACATGCGTCTAATGAAAAGAAGACAAATGGTGAATTAGATTTCCTGATGGCTGAATTTGCAGATGTCTCTCAACGTGGTAGAGAAAATGGGAATCTTGATTCCACTGCTAGAATTTCTCATAAAACAATAAATAAGGAGATAGGAACACTAGCATCTAACAAAGGAGCTGCTTCGACCTCTGGGATAGCCTCTCAGACGGCATCAGGAGTACTGTCTGGTTCTGGTGTTCTAAATGCTAGGCCAGGCAGTGCAACATCATCAGGTTTACTTTCCCACATGGTTTCAACGTTGAATGCAGATGTTGCAAGGGAATACCTAGAAAAGGTGGCAGATCTTCTGCTTGAGTTTGCACAAGCAGATACTACTGTAAAATCATACATGTGTAGCCAAAGTTTGCTCAGCCGTCTTTTCCAGATGTTCAATAGGGTGGAGCCCCCAATTCTTTTAAAGATACTGAAGTGTGTCAACTATTTATCAACTGATCCAAACTGCTTAGAGAATCTTCAGCGGGCAGATGCAATTAAATATTTGATTCCCAATCTCGAACTCAAAGAAGGAGCTCTTGTATCTCAAATCCATCATGAGGTCCTCAATGCCCTATTCAATCTTTGCAAGATTAACAAGAGAAGACAGGAACAAGCAGCTGAGAATGGAATAATTCCACACTTAATGCATTTTATTGAGTCTAATTCTCCTTTGAAACAATATGCGTTGCCTTTACTGTGTGATATGGCTCATGCATCACGTAATTCAAGGGAGCAATTAAGGGCTCATGGTGGATTGGATGTTTACTTGAGCCTTCTCGAGGATGAGCTTTGGTCTGTGACCGCATTGGATTCCATTGCTGTTTGTTTAGCTCTTGACAATGACAACCGGAAGGTGGAACAAGCGTTGTTGAGAAAGGATGCAGTTCAGAAATTGGTGAAATTCTTCCAGTGCTGTCCAGAACAGTATTTCGTGCACATATTGGAGCCATTTTTGAAAATTATCACGAAATCATCTCGAATTAATACAACATTAGCTGTTAATGGTTTGACACCGCTGCTTATTACAAGACTGGACCATCGGGATGCCATTGCCCGTCTAAATCTTCTTAAACTGATAAAGGCTGTTTATGAGCACCACCCGCGGCCAAAGCAGTTAATTGTGGAGAATGATCTGCCTCAGAAGCTACAGAATTTAATAGAGGAACGCAGAGATGGGCAACGCTCTGGAGGCCAAGTGTTGGTGAAACAAATGGCTACTTCGCTGCTTAAAGCACTCCATATTAACACCGTATTGTAA


Protein sequences

Name Description Sequence
ppa000241m mitogen-activated protein kinase kinase kinase 7 (best arabidopsis hit)

MSRQAGSSHFHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWIQNCRRALQSSIRHSGTLRKDASIDAEISNGDNQGSGESPAEKVEVAASTIKTDSKKELLSTEVSDMSKSDDDPASVLKFSEEKTDDLEDDVTDQVPTLAIHEKSSFQNGSDKIPSNKELATSDPTELDDLPHKGNHDAVLANGEVRSPESMTKNVSGKHGGKGVGYRSFGFGQRNQDGSFQKAAKMPVPLGGNELSKFSDTPGDASLDDLFHPLDKHPEDKATEASTSASMSILNQGTTSANDAGKSDLATKLRATIAQKQMESEMGQANGSGGNLLQLMMGVLKDDVIDIGGLVFDEKLPGENLFPLQAVEFSRLVGSLRPDESEDVIVSACQKLIAIFHQRPEQKSVFVTQHGLLPLMELLEVPKTRVICSVLQIINQIIKDNTDFQENACLVGLIPVVMSFAVPNHSREIRMEAAYFLQQLCQSSPLTLQMFIACRGIPVLVGFLEADYAKFREMVHLAIDGMWQVFKLQRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASISGGGGFPHDGSAQRARSGSLDSGHPIFAQSDTPLPTTDQHDMSKARHGMIDFHLSTGTAEPARASTSNSQRLDANQSDPRYLHLDTDRAQSSSVVVEASIPSKLPDSTSVDKVVNITTKERGDLDLRQQRATNSSSRASTDRPPKMMEVTSNGFPTTVAAQQEQVRPLLSLLEKEPPSRHFSGQLEYVRHLPGLERHESILPLLHASNEKKTNGELDFLMAEFADVSQRGRENGNLDSTARISHKTINKEIGTLASNKGAASTSGIASQTASGVLSGSGVLNARPGSATSSGLLSHMVSTLNADVAREYLEKVADLLLEFAQADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILKCVNYLSTDPNCLENLQRADAIKYLIPNLELKEGALVSQIHHEVLNALFNLCKINKRRQEQAAENGIIPHLMHFIESNSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLEDELWSVTALDSIAVCLALDNDNRKVEQALLRKDAVQKLVKFFQCCPEQYFVHILEPFLKIITKSSRINTTLAVNGLTPLLITRLDHRDAIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQMATSLLKALHINTVL*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
6-305 Protein kinase-like (PK-like)
Protein kinase-like domain

GSSHFHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWIQNCRRALQSSIRHSGTLRKDASIDAEISNGD

Gene3D: G3DSA:3.30.200.20
8-129 no description

SHFHKSKTLDNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVL

HMMPanther: PTHR24361
18-1412 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

NKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWIQNCRRALQSSIRHSGTLRKDASIDAEISNGDNQGSGESPAEKVEVAASTIKTDSKKELLSTEVSDMSKSDDDPASVLKFSEEKTDDLEDDVTDQVPTLAIHEKSSFQNGSDKIPSNKELATSDPTELDDLPHKGNHDAVLANGEVRSPESMTKNVSGKHGGKGVGYRSFGFGQRNQDGSFQKAAKMPVPLGGNELSKFSDTPGDASLDDLFHPLDKHPEDKATEASTSASMSILNQGTTSANDAGKSDLATKLRATIAQKQMESEMGQANGSGGNLLQLMMGVLKDDVIDIGGLVFDEKLPGENLFPLQAVEFSRLVGSLRPDESEDVIVSACQKLIAIFHQRPEQKSVFVTQHGLLPLMELLEVPKTRVICSVLQIINQIIKDNTDFQENACLVGLIPVVMSFAVPNHSREIRMEAAYFLQQLCQSSPLTLQMFIACRGIPVLVGFLEADYAKFREMVHLAIDGMWQVFKLQRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASISGGGGFPHDGSAQRARSGSLDSGHPIFAQSDTPLPTTDQHDMSKARHGMIDFHLSTGTAEPARASTSNSQRLDANQSDPRYLHLDTDRAQSSSVVVEASIPSKLPDSTSVDKVVNITTKERGDLDLRQQRATNSSSRASTDRPPKMMEVTSNGFPTTVAAQQEQVRPLLSLLEKEPPSRHFSGQLEYVRHLPGLERHESILPLLHASNEKKTNGELDFLMAEFADVSQRGRENGNLDSTARISHKTINKEIGTLASNKGAASTSGIASQTASGVLSGSGVLNARPGSATSSGLLSHMVSTLNADVAREYLEKVADLLLEFAQADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILKCVNYLSTDPNCLENLQRADAIKYLIPNLELKEGALVSQIHHEVLNALFNLCKINKRRQEQAAENGIIPHLMHFIESNSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLEDELWSVTALDSIAVCLALDNDNRKVEQALLRKDAVQKLVKFFQCCPEQYFVHILEPFLKIITKSSRINTTLAVNGLTPLLITRLDHRDAIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQMATSLLKALHIN

HMMPanther: PTHR24361:SF61
18-1412 SUBFAMILY NOT NAMED,NIK-RELATED PROTEIN KINASE

NKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWIQNCRRALQSSIRHSGTLRKDASIDAEISNGDNQGSGESPAEKVEVAASTIKTDSKKELLSTEVSDMSKSDDDPASVLKFSEEKTDDLEDDVTDQVPTLAIHEKSSFQNGSDKIPSNKELATSDPTELDDLPHKGNHDAVLANGEVRSPESMTKNVSGKHGGKGVGYRSFGFGQRNQDGSFQKAAKMPVPLGGNELSKFSDTPGDASLDDLFHPLDKHPEDKATEASTSASMSILNQGTTSANDAGKSDLATKLRATIAQKQMESEMGQANGSGGNLLQLMMGVLKDDVIDIGGLVFDEKLPGENLFPLQAVEFSRLVGSLRPDESEDVIVSACQKLIAIFHQRPEQKSVFVTQHGLLPLMELLEVPKTRVICSVLQIINQIIKDNTDFQENACLVGLIPVVMSFAVPNHSREIRMEAAYFLQQLCQSSPLTLQMFIACRGIPVLVGFLEADYAKFREMVHLAIDGMWQVFKLQRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASISGGGGFPHDGSAQRARSGSLDSGHPIFAQSDTPLPTTDQHDMSKARHGMIDFHLSTGTAEPARASTSNSQRLDANQSDPRYLHLDTDRAQSSSVVVEASIPSKLPDSTSVDKVVNITTKERGDLDLRQQRATNSSSRASTDRPPKMMEVTSNGFPTTVAAQQEQVRPLLSLLEKEPPSRHFSGQLEYVRHLPGLERHESILPLLHASNEKKTNGELDFLMAEFADVSQRGRENGNLDSTARISHKTINKEIGTLASNKGAASTSGIASQTASGVLSGSGVLNARPGSATSSGLLSHMVSTLNADVAREYLEKVADLLLEFAQADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILKCVNYLSTDPNCLENLQRADAIKYLIPNLELKEGALVSQIHHEVLNALFNLCKINKRRQEQAAENGIIPHLMHFIESNSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLEDELWSVTALDSIAVCLALDNDNRKVEQALLRKDAVQKLVKFFQCCPEQYFVHILEPFLKIITKSSRINTTLAVNGLTPLLITRLDHRDAIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQMATSLLKALHIN

HMMSmart: SM00219
IPR020635
20-274 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWI

ProfileScan: PS50011
IPR000719
20-274 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWI

HMMSmart: SM00220
IPR002290
20-274 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWI

HMMPfam: PF00069
IPR000719
22-274 Pkinase,Ser-thr
Protein kinase, catalytic domain

LGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIAQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTKTHLHIVLEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWI

PatternScan: PS00107
IPR017441
26-49 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGAYGRVYKGLDLENGDFVAIK

Gene3D: G3DSA:1.10.510.10
130-278 no description

EGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCVPPYYDLQPMPALFRIVQDEHPPIPDSLSHDITDFLGQCFKKDARHRPDAKTLLSHPWIQNCR

PatternScan: PS00108
IPR008271
140-152 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKGANILT

superfamily: SSF48371
IPR016024
587-785 ARM repeat,NBS
Armadillo-type fold

FSRLVGSLRPDESEDVIVSACQKLIAIFHQRPEQKSVFVTQHGLLPLMELLEVPKTRVICSVLQIINQIIKDNTDFQENACLVGLIPVVMSFAVPNHSREIRMEAAYFLQQLCQSSPLTLQMFIACRGIPVLVGFLEADYAKFREMVHLAIDGMWQVFKLQRSTPRNDFCRIAAKNGILLRLINTLYSLNEATRLASIS

HMMSmart: SM00185
IPR000225
617-657 Armadillo/beta-catenin-like repeats
Armadillo

RPEQKSVFVTQHGLLPLMELLEVPKTRVICSVLQIINQIIK

Seg: seg
951-962 seg

PLLSLLEKEPPS

superfamily: SSF48371
IPR016024
1075-1401 ARM repeat,NBS
Armadillo-type fold

SGLLSHMVSTLNADVAREYLEKVADLLLEFAQADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILKCVNYLSTDPNCLENLQRADAIKYLIPNLELKEGALVSQIHHEVLNALFNLCKINKRRQEQAAENGIIPHLMHFIESNSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLEDELWSVTALDSIAVCLALDNDNRKVEQALLRKDAVQKLVKFFQCCPEQYFVHILEPFLKIITKSSRINTTLAVNGLTPLLITRLDHRDAIARLNLLKLIKAVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRSGGQVLVKQM

Gene3D: G3DSA:1.25.10.10
IPR011989
1090-1304 no description
Armadillo-like helical

AREYLEKVADLLLEFAQADTTVKSYMCSQSLLSRLFQMFNRVEPPILLKILKCVNYLSTDPNCLENLQRADAIKYLIPNLELKEGALVSQIHHEVLNALFNLCKINKRRQEQAAENGIIPHLMHFIESNSPLKQYALPLLCDMAHASRNSREQLRAHGGLDVYLSLLEDELWSVTALDSIAVCLALDNDNRKVEQALLRKDAVQKLVKFFQCCPE

HMMSmart: SM00185
IPR000225
1149-1193 Armadillo/beta-catenin-like repeats
Armadillo

DPNCLENLQRADAIKYLIPNLELKEGALVSQIHHEVLNALFNLCK

HMMSmart: SM00185
IPR000225
1195-1234 Armadillo/beta-catenin-like repeats
Armadillo

NKRRQEQAAENGIIPHLMHFIESNSPLKQYALPLLCDMAH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox