PRGDB00172366 (ppa025019m)

From PRG Wiki
Revision as of 03:31, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa025019m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

disease resistance family protein / LRR family protein (best arabidopsis hit)

DNA Sequence

TTTCTTCTTGGGTGGGTCATGATTGTTGCCGCTGGGAAGGGATTTCATGCAACAACCGCACCAGTCATGTTGCCGAGATGGATCTCCGGAATACATATGACAAGTCCACGGCTGTTGAAGAGTGGGACGAGTTGGCTTATAGCCAGTCTCGCTTGGGGGTTCTTTGGGGAGCTTAAATCTCTGAGGTATCTCAATATCTCCTTTGCACAGTTTACAGGAGAGATTCCCTCTTCTCTTGGAAACTTGTCAAACTTGAACTATCTTGATGTCGGTTTTTCTTCATCCAAAATATATTCCAAAAACTTGAATTGGCTTTCTCATCTCTCTTCCCTAAAATACCTCAATCTCAATGAAGTGAATCTTAGTAGCAGCACAGGTTGGCTGCATGCTGTTAACATGCTTCCTTCCTTAGAGTCACTAGATTTGTCTGGTTGTGAGTTGGAAGGCCAATTGCCGGCCTCCTTCGGAATGTTAAAAAGTTTGCAGTACTTGGACCTCTCTTTTAATCACATGAACGGGTCCATTCCACAAAGTCTAGGACAACTCTCCGAGCTAGTTGAACTCAATCTGTCTTTCAATTCATGGGAAGGTATTCTAACGGAAGCCCATTTCATTAATCTCACCAAATTGAAAAGTCTTTCAATAGGTAACAATCTTGATGACATAGAGAAGCCCATGTCCCTCGTTTTCAACTTGTCTCATGATTGGGTTCCTTCTTTCAAGCTCCACACAATTGTGATTAGAAACTACAAAGTAGGTCCTGGTTTTCCTGTATGGCTTCAATCTCAGACTGAACTAGTACAGGTTGTCCTTCGTAGAACTGGAATATCAGATTCTATACCAGAGGAATGGTTGTTGAAGCTATCTTCCCAACTAGAATACCTGGATTTATCTCATAACCAATTCCGAGGAAGGCTTTCATCCAACCAATTGATGAGATTTCCGAAGTTACGTTTATTAAATTTGGCTCATAATCAATTTGAGGGCCCACTCCCACTTTGGTCCACTAATGCATCTTACTTTGATCTTGAAAGCAATTTATTTTACGGGCCAATTTCCTCCAATTTTGACAAACTAATGCCCAAATTGGAAGAATTGTATATTTCGGAAAATCATTTGAATGGTACAATTCCACCTTCTATTTGCAACATGCAAAACCTAACAATCCTTTCCCTGAGGAGCAATCATTTTTTTGGAGAATTCCCCCACACTTGGAGTTCGTGGAGCCAGATAACCATTGTAGATGCTGCCTACAACAATCTCTCTGGTAATATTCCCACTTCAATGGGAATATTAAGTTCTCTTGAAATATTGAAGCTCAACAACAACAATTTTGGCGATAAGATTCCCGATTCTTTGCACAATTGCTCTGCTTTGAAAATTATCGATCTTGGAGGCAACAAATTATCTGGGAGCATACCTCCATGGATAGGAGGATCAAATGTATCCATGTTGTGCATGCTACGATTGCAATCCAACTTTTTCACTGGACATATTCCCCGACAATTGTGCAATCTTGGCTACCTTCACATCCTCGACCTCAGCCACAACAACTTTTCAGGTACTATTCCCACATGCTTCAATAATTTGACTTCTCTCATCCATAATGTTTCCGATATATACAACAACTACTATCTTCCACAAACCATGGTGATATTAAAAGGACAAGAACGCGTTTATAACACCACTCTAATGCTGGTAAAGAGCATTGATCTTTCATCAAATATTTTGGAAGGTGAAATCCCTCAAGAAATTGGTGGCCTCACTTTATTGGGTACCTTGAACTTGTCGAGGAATCATTTGACTGGTAACATCCCCTCGATTGTTGGAAATATGCATGGGCTCGAAACTCTTGATCTTTCAAACAACCGTCTTTCAGGACAAATTCCTCGAAGCCTTGAATCTTTAACATTCTTGTCGCACTTGAATTTGGCTAATAACAACTTGGTGGGGAGAATTCCCTTGGGCAGCCAACTCCAAACGTTCACTGATTCTTCCATTTATATGGGCAATCCATCACTTTGTGGCTTTCCTCTTCCAACTAAGTGCCCTGGAGATGACACTTTGACCATTACAAATGCGAAACACAATAATGAAGATGGAAATGATAAGATGTGGTTCTATGTGGGCATGGGACTTGGCTTTATCGTAGGCTTTTGGGGTGTTTTTGGCACATTACTCGTGAAGAAATCATGGAGGTATGCTTATTTTCGATTTTTTGATGACACCAAAGATAAAGTAACACTAGCAATTGAGTTGAAAGTGACTCGTTTGCAAAGAAAGTTTTGTCATGTTTAG


Protein sequences

Name Description Sequence
ppa025019m disease resistance family protein / LRR family protein (best arabidopsis hit)

FLLGWVMIVAAGKGFHATTAPVMLPRWISGIHMTSPRLLKSGTSWLIASLAWGFFGELKSLRYLNISFAQFTGEIPSSLGNLSNLNYLDVGFSSSKIYSKNLNWLSHLSSLKYLNLNEVNLSSSTGWLHAVNMLPSLESLDLSGCELEGQLPASFGMLKSLQYLDLSFNHMNGSIPQSLGQLSELVELNLSFNSWEGILTEAHFINLTKLKSLSIGNNLDDIEKPMSLVFNLSHDWVPSFKLHTIVIRNYKVGPGFPVWLQSQTELVQVVLRRTGISDSIPEEWLLKLSSQLEYLDLSHNQFRGRLSSNQLMRFPKLRLLNLAHNQFEGPLPLWSTNASYFDLESNLFYGPISSNFDKLMPKLEELYISENHLNGTIPPSICNMQNLTILSLRSNHFFGEFPHTWSSWSQITIVDAAYNNLSGNIPTSMGILSSLEILKLNNNNFGDKIPDSLHNCSALKIIDLGGNKLSGSIPPWIGGSNVSMLCMLRLQSNFFTGHIPRQLCNLGYLHILDLSHNNFSGTIPTCFNNLTSLIHNVSDIYNNYYLPQTMVILKGQERVYNTTLMLVKSIDLSSNILEGEIPQEIGGLTLLGTLNLSRNHLTGNIPSIVGNMHGLETLDLSNNRLSGQIPRSLESLTFLSHLNLANNNLVGRIPLGSQLQTFTDSSIYMGNPSLCGFPLPTKCPGDDTLTITNAKHNNEDGNDKMWFYVGMGLGFIVGFWGVFGTLLVKKSWRYAYFRFFDDTKDKVTLAIELKVTRLQRKFCHV*


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
47-218 no description

IASLAWGFFGELKSLRYLNISFAQFTGEIPSSLGNLSNLNYLDVGFSSSKIYSKNLNWLSHLSSLKYLNLNEVNLSSSTGWLHAVNMLPSLESLDLSGCELEGQLPASFGMLKSLQYLDLSFNHMNGSIPQSLGQLSELVELNLSFNSWEGILTEAHFINLTKLKSLSIGNN

superfamily: SSF52047
50-374 RNI-like,LRR

LAWGFFGELKSLRYLNISFAQFTGEIPSSLGNLSNLNYLDVGFSSSKIYSKNLNWLSHLSSLKYLNLNEVNLSSSTGWLHAVNMLPSLESLDLSGCELEGQLPASFGMLKSLQYLDLSFNHMNGSIPQSLGQLSELVELNLSFNSWEGILTEAHFINLTKLKSLSIGNNLDDIEKPMSLVFNLSHDWVPSFKLHTIVIRNYKVGPGFPVWLQSQTELVQVVLRRTGISDSIPEEWLLKLSSQLEYLDLSHNQFRGRLSSNQLMRFPKLRLLNLAHNQFEGPLPLWSTNASYFDLESNLFYGPISSNFDKLMPKLEELYISENHLN

HMMSmart: SM00369
IPR003591
58-82 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLRYLNISFAQFTGEIPSSLGNL

HMMPfam: PF13516
58-81 LRR_6,Leucine Rich repeat

LKSLRYLNISFAQFTGEIPSSLGN

HMMPanther: PTHR24420
62-738 FAMILY NOT NAMED,FAMILY NOT NAMED

RYLNISFAQFTGEIPSSLGNLSNLNYLDVGFSSSKIYSKNLNWLSHLSSLKYLNLNEVNLSSSTGWLHAVNMLPSLESLDLSGCELEGQLPASFGMLKSLQYLDLSFNHMNGSIPQSLGQLSELVELNLSFNSWEGILTEAHFINLTKLKSLSIGNNLDDIEKPMSLVFNLSHDWVPSFKLHTIVIRNYKVGPGFPVWLQSQTELVQVVLRRTGISDSIPEEWLLKLSSQLEYLDLSHNQFRGRLSSNQLMRFPKLRLLNLAHNQFEGPLPLWSTNASYFDLESNLFYGPISSNFDKLMPKLEELYISENHLNGTIPPSICNMQNLTILSLRSNHFFGEFPHTWSSWSQITIVDAAYNNLSGNIPTSMGILSSLEILKLNNNNFGDKIPDSLHNCSALKIIDLGGNKLSGSIPPWIGGSNVSMLCMLRLQSNFFTGHIPRQLCNLGYLHILDLSHNNFSGTIPTCFNNLTSLIHNVSDIYNNYYLPQTMVILKGQERVYNTTLMLVKSIDLSSNILEGEIPQEIGGLTLLGTLNLSRNHLTGNIPSIVGNMHGLETLDLSNNRLSGQIPRSLESLTFLSHLNLANNNLVGRIPLGSQLQTFTDSSIYMGNPSLCGFPLPTKCPGDDTLTITNAKHNNEDGNDKMWFYVGMGLGFIVGFWGVFGTLLVKKSWRYAYFR

HMMPanther: PTHR24420:SF473
62-738 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RYLNISFAQFTGEIPSSLGNLSNLNYLDVGFSSSKIYSKNLNWLSHLSSLKYLNLNEVNLSSSTGWLHAVNMLPSLESLDLSGCELEGQLPASFGMLKSLQYLDLSFNHMNGSIPQSLGQLSELVELNLSFNSWEGILTEAHFINLTKLKSLSIGNNLDDIEKPMSLVFNLSHDWVPSFKLHTIVIRNYKVGPGFPVWLQSQTELVQVVLRRTGISDSIPEEWLLKLSSQLEYLDLSHNQFRGRLSSNQLMRFPKLRLLNLAHNQFEGPLPLWSTNASYFDLESNLFYGPISSNFDKLMPKLEELYISENHLNGTIPPSICNMQNLTILSLRSNHFFGEFPHTWSSWSQITIVDAAYNNLSGNIPTSMGILSSLEILKLNNNNFGDKIPDSLHNCSALKIIDLGGNKLSGSIPPWIGGSNVSMLCMLRLQSNFFTGHIPRQLCNLGYLHILDLSHNNFSGTIPTCFNNLTSLIHNVSDIYNNYYLPQTMVILKGQERVYNTTLMLVKSIDLSSNILEGEIPQEIGGLTLLGTLNLSRNHLTGNIPSIVGNMHGLETLDLSNNRLSGQIPRSLESLTFLSHLNLANNNLVGRIPLGSQLQTFTDSSIYMGNPSLCGFPLPTKCPGDDTLTITNAKHNNEDGNDKMWFYVGMGLGFIVGFWGVFGTLLVKKSWRYAYFR

Seg: seg
77-86 seg

SSLGNLSNLN

ProfileScan: PS51450
IPR001611
110-131 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKYLNLNEVNLSSSTGWLHAV

HMMSmart: SM00369
IPR003591
134-157 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPSLESLDLSGCELEGQLPASFGM

HMMPfam: PF13855
135-194 LRR_8,Leucine rich repeat

PSLESLDLSGCELEGQLPASFGMLKSLQYLDLSFNHMNGSIPQSLGQLSELVELNLSFNS

ProfileScan: PS51450
IPR001611
136-158 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLESLDLSGCELEGQLPASFGML

HMMSmart: SM00369
IPR003591
158-182 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLQYLDLSFNHMNGSIPQSLGQL

ProfileScan: PS51450
IPR001611
160-182 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQYLDLSFNHMNGSIPQSLGQL

ProfileScan: PS51450
IPR001611
184-205 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELVELNLSFNSWEGILTEAHFI

ProfileScan: PS51450
IPR001611
209-229 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKSLSIGNNLDDIEKPMSLV

Gene3D: G3DSA:3.80.10.10
256-423 no description

FPVWLQSQTELVQVVLRRTGISDSIPEEWLLKLSSQLEYLDLSHNQFRGRLSSNQLMRFPKLRLLNLAHNQFEGPLPLWSTNASYFDLESNLFYGPISSNFDKLMPKLEELYISENHLNGTIPPSICNMQNLTILSLRSNHFFGEFPHTWSSWSQITIVDAAYNNLSG

ProfileScan: PS51450
IPR001611
291-313 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEYLDLSHNQFRGRLSSNQLMR

HMMPfam: PF00560
IPR001611
291-311 LRR_1
Leucine-rich repeat

QLEYLDLSHNQFRGRLSSNQL

FPrintScan: PR00019
292-305 LEURICHRPT,Leucine-rich repeat signature

LEYLDLSHNQFRGR

ProfileScan: PS51450
IPR001611
316-337 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRLLNLAHNQFEGPLPLWSTN

superfamily: SSF52058
359-670 L domain-like,LRR

LMPKLEELYISENHLNGTIPPSICNMQNLTILSLRSNHFFGEFPHTWSSWSQITIVDAAYNNLSGNIPTSMGILSSLEILKLNNNNFGDKIPDSLHNCSALKIIDLGGNKLSGSIPPWIGGSNVSMLCMLRLQSNFFTGHIPRQLCNLGYLHILDLSHNNFSGTIPTCFNNLTSLIHNVSDIYNNYYLPQTMVILKGQERVYNTTLMLVKSIDLSSNILEGEIPQEIGGLTLLGTLNLSRNHLTGNIPSIVGNMHGLETLDLSNNRLSGQIPRSLESLTFLSHLNLANNNLVGRIPLGSQLQTFTDSSIYMG

HMMSmart: SM00369
IPR003591
360-384 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPKLEELYISENHLNGTIPPSICNM

HMMPfam: PF12799
361-397 LRR_4,Leucine Rich repeats (2 copies)

PKLEELYISENHLNGTIPPSICNMQNLTILSLRSNHF

ProfileScan: PS51450
IPR001611
362-384 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEELYISENHLNGTIPPSICNM

HMMSmart: SM00369
IPR003591
432-456 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEILKLNNNNFGDKIPDSLHNC

ProfileScan: PS51450
IPR001611
434-456 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILKLNNNNFGDKIPDSLHNC

HMMPfam: PF00560
IPR001611
434-456 LRR_1
Leucine-rich repeat

SLEILKLNNNNFGDKIPDSLHNC

ProfileScan: PS51450
IPR001611
458-480 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKIIDLGGNKLSGSIPPWIGGS

HMMPfam: PF00560
IPR001611
459-478 LRR_1
Leucine-rich repeat

LKIIDLGGNKLSGSIPPWIG

HMMSmart: SM00369
IPR003591
506-529 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LGYLHILDLSHNNFSGTIPTCFNN

ProfileScan: PS51450
IPR001611
508-531 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLHILDLSHNNFSGTIPTCFNNLT

HMMPfam: PF00560
IPR001611
509-530 LRR_1
Leucine-rich repeat

LHILDLSHNNFSGTIPTCFNNL

Gene3D: G3DSA:3.80.10.10
569-679 no description

SIDLSSNILEGEIPQEIGGLTLLGTLNLSRNHLTGNIPSIVGNMHGLETLDLSNNRLSGQIPRSLESLTFLSHLNLANNNLVGRIPLGSQLQTFTDSSIYMGNPSLCGFPL

Seg: seg
586-596 seg

GGLTLLGTLNL

HMMSmart: SM00369
IPR003591
588-611 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTLLGTLNLSRNHLTGNIPSIVGN

ProfileScan: PS51450
IPR001611
590-612 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLGTLNLSRNHLTGNIPSIVGNM

HMMPfam: PF13855
591-649 LRR_8,Leucine rich repeat

LGTLNLSRNHLTGNIPSIVGNMHGLETLDLSNNRLSGQIPRSLESLTFLSHLNLANNNL

HMMSmart: SM00369
IPR003591
612-640 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MHGLETLDLSNNRLSGQIPRSLESLTFLS

FPrintScan: PR00019
612-625 LEURICHRPT,Leucine-rich repeat signature

MHGLETLDLSNNRL

ProfileScan: PS51450
IPR001611
614-637 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLETLDLSNNRLSGQIPRSLESLT

ProfileScan: PS51450
IPR001611
638-660 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSHLNLANNNLVGRIPLGSQLQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox