PRGDB00172374 (ppa018586m)

From PRG Wiki
Revision as of 03:31, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa018586m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

GCTGTTTTCATATCCTTGAAGGGGGCATGGACGAATCTTCCACCCAGCTGGAACGACAAGTCAAATGATCCCTGTGGAATGAACTGGGAAGGAGTCACCTGCAACAATTCGAGGGTGACCGCATTGGGATTATCAGCAATGGACTTGAAAGGACAAATTGAAGGCGATATCGGGGGACTCTCTGAATTAAGATCCTTGGACCTTTCATTCAACAAAGGCCTCACGGGTTCTCTGTCTCCACGATTAGGAGATCTGAGCAAGTTAAATATCCTGATCCTAGCGGGCTGCGGCTTCAGTGGCAATATTCCAGAGGAATTGGGCAATCTTGGAGAGCTAACTTTCTTGGCTCTGAATACGAATAAATTTACTGGTCAAATACCTCCTTCTTTGGGTAAACTCTCCAAACTTAACTGGTTGGACCTGGTAGACAATCAGTTGACTGGAACTCTACCAATTTCAACCCCCCTTACCTCAGGCTTAGACAATTTATTGAAGGCTGAACACTTCCATTTCAGCAAGAACAACCTTTCAGGTACCATTCATCCCAAACTTTTCAGCTCTAAGATGAAACTGATACACATTTTGTTTGATGGAAATCAATTTATTCGGGAGATTCCATCAACCATAGCACTCGTTCAGACTCTTGAGGTTCTTCGGCTTGATAGAAATGCTCTGACAGGAAATGTCCCCTCAAATATCAGCAACCTAACACATGTCAATGAACTAAATTTGGCTCACAACAAATTGACAGGCCCTTTACCTGACTTAACTGGAATGAGGTCCCTCCATACTGTAGACCTGAGTAACAACTCATTTGACCCATCAGAAGCTCCACTTTGGTTCTCGAACTTACCCTCAATCACCACTATCGTTTTAGAATTTGGAGCACTTGAAGGGACTGTGCCAGAGAAGATGTTCGGCATCAAAACATTGCAGCAAGTGAAACTGAAAAACAATGCGTTTAACGATACATTGAACTTGGGTGATAGCATCAGTCCACAACTGCAGCTTGTTGATCTGCAGCACAATCAGATTCCTAAAATAACTCTGGGTTATAAATACAAACATACATTAATACTTGTAGAGAACCCATTTTGCACCAGTGGAACTGCCGTCACTAAATTCTGTCAGCTTCCGCAACAAGATACAGAAACGTATACTACTAGCTCGAATTGTGCACGCATTACATGCCCCGATAATCAGAAGCCCAGCCCTCAGAGTTGTCAATGTGCATATCCTTTCAAAGGAACATTGTATTTCAGAGCACCCCCTTTCAGGGAATTGCCAAATGTGACTATGTTTCACGCACTAGAAACGATTCTATGGGAAATACTTGGCCTCATTCCTGGTTCAGTTTCTCTTGAAAACCCTTTCTTCGACAATCATGACTATCTTCAAATTCAGCTGGCACTCTTTCCACCTACAGGAATGTATTTTAATAGGTCAGAGATTATGAGGATTGGTTTAGATTTGAACTACCAAAATCAAAAGCCACCGGAGGGGTTTGGACCCTATTATTTTATTCCATATCCTTATACTTTCCCGGGTGGGAATAAAAGTTCTATGAGCACTGGTGTTATTATTGGGACATCAGTTAGTTGTGTAGCTCTTGTACTGGGCCTCGTGGTAGTGGGAATATATGCCATTAGGCAAAAGAAACGTGCAGAAAGAGCCATTGGATTAAGCCGACCTTTTGCTTCTTGGGCACCAAGCGGAAAAGACAGTGGTGGAGCACCACAGTTAAAGGGAGCAAGATGTTTTTCTTTTGATGAGCTTAAGAAATGCACAAATAATTTCTCTGACAGTAATGAGATAGGATCTGGTGGATACGGGAAGGTTTACAGGGGCATGCTTTCTGATGGACAAGTGGTGGCAATCAAAAGAGCTCAGCAAGGATCAATGCAGGGTGGCCTTGAGTTCAAGACTGAAATCGAGTTGCTCTCGCGAGTTCATCACAAAAATGTTGTTGGCCTTTTGGGATTTTGTTTTGAACAAGGAGAACAGGTGCTGGTATATGAGTTTATTCCGAATGGAACACTCAGGGAAAGCTTGTCAGGGAGATCTGGTATTCATCTTGATTGGCAGAGGAGACTCCGCATCACTCTTGGCTCGGCAAGAGGACTAGCTTACCTACATGAGCTTGCAAATCCTCCTATAATTCACAGAGATGTGAAGTCCGCCAACATTCTATTAGATGAACATTTAACCGCGAAGGTTACAGATTTCGGCTTGTCCAAGCTGGTAGCTGACAGTGGAAAAGGGCATGTCTCAAGTCAGGTCAAAGGCACAATGGGATATCTTGATCCTGAATACTACACGACTCAACAGTTAACTGAGAAGAGTGATGTATACAGCTTTGGAGTAGTGATGCTTGAATTGATTACGGCTAGGAAGCCTATTGAGATGGGAAAATACATCGTCCGCCAGGTACAAATGATGATGGACAAGAATGATGAAGAACACTATGGTTTGAGGGAGTTAATGGATCGAAGCATTCGAAACTCTGGAACTCTTACTGGGTTTGGGAGGTTCCTGGAGCTGGCCCTGCAATGCGTTGAAGAATCAGCTGCAGACCGCCCCACAATGAGTGAGCTTGTGAAGGCTATTGAAACCATTCTGCAGAATGATGGCATGAACACAAACTCAACATCAGCATCTTCATCAGCCACAGAATTTGCAGCATCAAAAGGAGCTCCTAAGCATCCATACAACGATGGCTTGCCGAAAAAGGAAGTGAATGACAGCACTGGTGCCTTTTATTACAGTAGTGGATACGCAGTTTCGGCCAAGATTGAACCCAATTAG


Protein sequences

Name Description Sequence
ppa018586m Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

AVFISLKGAWTNLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLNWLDLVDNQLTGTLPISTPLTSGLDNLLKAEHFHFSKNNLSGTIHPKLFSSKMKLIHILFDGNQFIREIPSTIALVQTLEVLRLDRNALTGNVPSNISNLTHVNELNLAHNKLTGPLPDLTGMRSLHTVDLSNNSFDPSEAPLWFSNLPSITTIVLEFGALEGTVPEKMFGIKTLQQVKLKNNAFNDTLNLGDSISPQLQLVDLQHNQIPKITLGYKYKHTLILVENPFCTSGTAVTKFCQLPQQDTETYTTSSNCARITCPDNQKPSPQSCQCAYPFKGTLYFRAPPFRELPNVTMFHALETILWEILGLIPGSVSLENPFFDNHDYLQIQLALFPPTGMYFNRSEIMRIGLDLNYQNQKPPEGFGPYYFIPYPYTFPGGNKSSMSTGVIIGTSVSCVALVLGLVVVGIYAIRQKKRAERAIGLSRPFASWAPSGKDSGGAPQLKGARCFSFDELKKCTNNFSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETILQNDGMNTNSTSASSSATEFAASKGAPKHPYNDGLPKKEVNDSTGAFYYSSGYAVSAKIEPN*

Domains

Domain Start-End Description Sequence

HMMPfam: PF08263
IPR013210
4-35 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ISLKGAWTNLPPSWNDKSNDPCGMNWEGVTCN

HMMPanther: PTHR24420:SF476
5-933 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SLKGAWTNLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLNWLDLVDNQLTGTLPISTPLTSGLDNLLKAEHFHFSKNNLSGTIHPKLFSSKMKLIHILFDGNQFIREIPSTIALVQTLEVLRLDRNALTGNVPSNISNLTHVNELNLAHNKLTGPLPDLTGMRSLHTVDLSNNSFDPSEAPLWFSNLPSITTIVLEFGALEGTVPEKMFGIKTLQQVKLKNNAFNDTLNLGDSISPQLQLVDLQHNQIPKITLGYKYKHTLILVENPFCTSGTAVTKFCQLPQQDTETYTTSSNCARITCPDNQKPSPQSCQCAYPFKGTLYFRAPPFRELPNVTMFHALETILWEILGLIPGSVSLENPFFDNHDYLQIQLALFPPTGMYFNRSEIMRIGLDLNYQNQKPPEGFGPYYFIPYPYTFPGGNKSSMSTGVIIGTSVSCVALVLGLVVVGIYAIRQKKRAERAIGLSRPFASWAPSGKDSGGAPQLKGARCFSFDELKKCTNNFSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETILQNDGMNTNSTSASSSATEFAASKGAPKHPYNDGLPKKEVNDSTGAFYYSSGYAVSAKIEP

HMMPanther: PTHR24420
5-933 FAMILY NOT NAMED,FAMILY NOT NAMED

SLKGAWTNLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLNWLDLVDNQLTGTLPISTPLTSGLDNLLKAEHFHFSKNNLSGTIHPKLFSSKMKLIHILFDGNQFIREIPSTIALVQTLEVLRLDRNALTGNVPSNISNLTHVNELNLAHNKLTGPLPDLTGMRSLHTVDLSNNSFDPSEAPLWFSNLPSITTIVLEFGALEGTVPEKMFGIKTLQQVKLKNNAFNDTLNLGDSISPQLQLVDLQHNQIPKITLGYKYKHTLILVENPFCTSGTAVTKFCQLPQQDTETYTTSSNCARITCPDNQKPSPQSCQCAYPFKGTLYFRAPPFRELPNVTMFHALETILWEILGLIPGSVSLENPFFDNHDYLQIQLALFPPTGMYFNRSEIMRIGLDLNYQNQKPPEGFGPYYFIPYPYTFPGGNKSSMSTGVIIGTSVSCVALVLGLVVVGIYAIRQKKRAERAIGLSRPFASWAPSGKDSGGAPQLKGARCFSFDELKKCTNNFSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETILQNDGMNTNSTSASSSATEFAASKGAPKHPYNDGLPKKEVNDSTGAFYYSSGYAVSAKIEP

superfamily: SSF52058
10-409 L domain-like,LRR

WTNLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLNWLDLVDNQLTGTLPISTPLTSGLDNLLKAEHFHFSKNNLSGTIHPKLFSSKMKLIHILFDGNQFIREIPSTIALVQTLEVLRLDRNALTGNVPSNISNLTHVNELNLAHNKLTGPLPDLTGMRSLHTVDLSNNSFDPSEAPLWFSNLPSITTIVLEFGALEGTVPEKMFGIKTLQQVKLKNNAFNDTLNLGDSISPQLQLVDLQHNQIPKITLGYKYKHTLILVENPFCTSGTAVTKFCQLPQQDTETYTTSSNCARITCPDNQKPSPQSCQ

Gene3D: G3DSA:3.80.10.10
12-213 no description

NLPPSWNDKSNDPCGMNWEGVTCNNSRVTALGLSAMDLKGQIEGDIGGLSELRSLDLSFNKGLTGSLSPRLGDLSKLNILILAGCGFSGNIPEELGNLGELTFLALNTNKFTGQIPPSLGKLSKLNWLDLVDNQLTGTLPISTPLTSGLDNLLKAEHFHFSKNNLSGTIHPKLFSSKMKLIHILFDGNQFIREIPSTIALVQ

HMMPfam: PF00560
IPR001611
63-84 LRR_1
Leucine-rich repeat

LRSLDLSFNKGLTGSLSPRLGD

Gene3D: G3DSA:3.80.10.10
214-348 no description

TLEVLRLDRNALTGNVPSNISNLTHVNELNLAHNKLTGPLPDLTGMRSLHTVDLSNNSFDPSEAPLWFSNLPSITTIVLEFGALEGTVPEKMFGIKTLQQVKLKNNAFNDTLNLGDSISPQLQLVDLQHNQIPKI

Seg: seg
498-517 seg

PPEGFGPYYFIPYPYTFPGG

Seg: seg
535-545 seg

VALVLGLVVVG

superfamily: SSF56112
IPR011009
571-876 Protein kinase-like (PK-like)
Protein kinase-like domain

SGKDSGGAPQLKGARCFSFDELKKCTNNFSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETILQND

Gene3D: G3DSA:3.30.200.20
581-660 no description

LKGARCFSFDELKKCTNNFSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLG

HMMSmart: SM00219
IPR020635
599-869 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAI

HMMSmart: SM00220
IPR002290
599-873 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETIL

ProfileScan: PS50011
IPR000719
599-873 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDSNEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKAIETIL

HMMPfam: PF07714
IPR001245
603-868 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NEIGSGGYGKVYRGMLSDGQVVAIKRAQQGSMQGGLEFKTEIELLSRVHHKNVVGLLGFCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKA

PatternScan: PS00107
IPR017441
605-627 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGYGKVYRGMLSDGQVVAIK

Gene3D: G3DSA:1.10.510.10
661-868 no description

FCFEQGEQVLVYEFIPNGTLRESLSGRSGIHLDWQRRLRITLGSARGLAYLHELANPPIIHRDVKSANILLDEHLTAKVTDFGLSKLVADSGKGHVSSQVKGTMGYLDPEYYTTQQLTEKSDVYSFGVVMLELITARKPIEMGKYIVRQVQMMMDKNDEEHYGLRELMDRSIRNSGTLTGFGRFLELALQCVEESAADRPTMSELVKA

PatternScan: PS00108
IPR008271
719-731 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSANILL

Seg: seg
882-895 seg

STSASSSATEFAAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox