PRGDB00172381 (ppa024091m)

From PRG Wiki
Revision as of 03:31, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa024091m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCTCATGCCTTCCTTCTCTTCCTCTTATTCTCTTGCATTACATCTACGAATATTCATGCATGCAAACACACTGAACGCAGCTCTCTCCTGTCGTTTGCCTCCACTGTATCTTCTCCTCCTTTAAATTGGACGACATCCCTTGATTGCTGTCGTTGGAAGGGCATCACTTGTAATCAAGATGGTTGGGTCACCCATTTGCTCTTGCCTTCCAAAGGGCTCAAAGGAGGTCTCTCTACATCTTCACTTGGAAATCTCACACATCTCACCCACTTGAACCTTTCCCACAATTCACTATATGGTTCACTTGAAAATCAGTTCTTCTTGTCTTTGAATCGACTCGAGTTGCTTGATTTGAGCTATAATCTTCTTTCTGGAGAGCTACCATTTTCTCCACCATCCAGCAAAATCCGGACAGTCGATTTGTCTAGCAATCACTTTCATGGTGCAATTCCATCTTCATTCTTCCAACAAGCAAGCAACTTGACTAGTTTCAATGTCAGCAACAATACCTTCACAGGGTATGTCCCATCCTCTATTTGTCTCCATTCTTCTCCCTTCCTTAGGCTATTGGATTTTTCTTCCAATCTATTCAATGGAAACCTTGCTCCTGGACTAGGGAAGTGTTCCAAACTGCAGGTTTTTCGTGCAGGTCACAATAACCTCTCAGGATTACTTCCAGGAGATATTTATAATGCTACCAAACTTGAAGAAATTGCAATACCTCTCAGTTCACTACATGGGGCCATTAGTGATAAAATTGTTAACCTCACCAACCTTGCAATCCTTGATCTCTACATTAATCAATTAAGCGGTGAGCTTCCTCTCAATTTGGGGAAGCTTTCCAAGTTGAAGTTTGTGGCCCTTGATTTCAACCTTTTAGAAGGTGCTTTGCCCCCATCTTTGATGAATTGCACAAACCTTGTAGAACTACGTTTGGGAACAAACAACTTGGAAGGAAATATCTCCATGCTTGATTTCTCCAAACTTAACCAACTTGCTAAACTTGACCTAAGGGTCAACAACTTCACTGGTACGTTTCCCGTAAGCCTTTACTCATGTAGGTCCCTAAAGGCCATTCGGTTGACTGGAAATAATCTAGCGGGACAGATACAAGCTCAGATTCTTTCATTGAAATCCTTGTCCTTCCTCTCGCTTGGTTTCAACCAATTCACCAATCTCACGGGGGCAATGAAGATATTGATGCATTGCAAAAGTCTTCACGCACTCATGCTTAGTGGTTCCTTTAAAGGTGAGGGAATGCCAGCTGATGATGACATGGTTGATTTTGACGGATTCCAAAATCTTCGGGTATTGTGTTTGGTTGATAGTCGCCTTACTGGTCAACTACCTGTGTGGTTATCAAAGCTCCAAAATCTAAAGATTTTGCTTCTAAGTGGTAATGAAATAACAGGGCCAATTCCAAGTTGGTTGGGGACTCTTCCTAGATTGTTTTATATCAAGTTGTCAGAGAACCGATTTTCAGGTGAATTTCCAAAGCAACTGTGTAGACTACCAAGGTTGGTATATGAACCCAATATTACATCTCAAGTAGATGACACTAGTAATGAATTTGAATTGCCTTTCTACTTTCACACTCTCGCCAGAAACCCAAATTATTATTTGTCGTCCAAAATTTCTTCCTATCCAGCAACGATAGACTTATCAAACAATAACATTGTTGGTGACATACCTATTGAGGTCGGCCAATTACAGTTTCTCCGTGGGTTGGTTCTTCACTCCAACAACTTCTCCGGCGTCATTCCAGACCAAATATCTAACCTAAAAAATTTAGAGGTTTTGAACCTCTCCATGAACCACTTGTCTGGAATAATCCCATCGTCATTGGCGAGCCTTACTTTCTTGAAAGAATTTAATGTCTCATACAATAATCTCCAAGGACCAATACCAACAAGCACTCAGCTCCAAAGCTTCAACGCTTCTGCCTTTGAGGGGAATCCAAAACTTTGTGGTGCACCACTTCCAAATAAGTTTTCTTTCACGCTACCTTTTGCAAGCAACAATAAAGAGGGATTTTGGCTGTCCAAAGTCATGAATACTATATCAAATGAATACAAAAATGGGTAG


Protein sequences

Name Description Sequence
ppa024091m Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

MAHAFLLFLLFSCITSTNIHACKHTERSSLLSFASTVSSPPLNWTTSLDCCRWKGITCNQDGWVTHLLLPSKGLKGGLSTSSLGNLTHLTHLNLSHNSLYGSLENQFFLSLNRLELLDLSYNLLSGELPFSPPSSKIRTVDLSSNHFHGAIPSSFFQQASNLTSFNVSNNTFTGYVPSSICLHSSPFLRLLDFSSNLFNGNLAPGLGKCSKLQVFRAGHNNLSGLLPGDIYNATKLEEIAIPLSSLHGAISDKIVNLTNLAILDLYINQLSGELPLNLGKLSKLKFVALDFNLLEGALPPSLMNCTNLVELRLGTNNLEGNISMLDFSKLNQLAKLDLRVNNFTGTFPVSLYSCRSLKAIRLTGNNLAGQIQAQILSLKSLSFLSLGFNQFTNLTGAMKILMHCKSLHALMLSGSFKGEGMPADDDMVDFDGFQNLRVLCLVDSRLTGQLPVWLSKLQNLKILLLSGNEITGPIPSWLGTLPRLFYIKLSENRFSGEFPKQLCRLPRLVYEPNITSQVDDTSNEFELPFYFHTLARNPNYYLSSKISSYPATIDLSNNNIVGDIPIEVGQLQFLRGLVLHSNNFSGVIPDQISNLKNLEVLNLSMNHLSGIIPSSLASLTFLKEFNVSYNNLQGPIPTSTQLQSFNASAFEGNPKLCGAPLPNKFSFTLPFASNNKEGFWLSKVMNTISNEYKNG*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
6-658 FAMILY NOT NAMED,FAMILY NOT NAMED

LLFLLFSCITSTNIHACKHTERSSLLSFASTVSSPPLNWTTSLDCCRWKGITCNQDGWVTHLLLPSKGLKGGLSTSSLGNLTHLTHLNLSHNSLYGSLENQFFLSLNRLELLDLSYNLLSGELPFSPPSSKIRTVDLSSNHFHGAIPSSFFQQASNLTSFNVSNNTFTGYVPSSICLHSSPFLRLLDFSSNLFNGNLAPGLGKCSKLQVFRAGHNNLSGLLPGDIYNATKLEEIAIPLSSLHGAISDKIVNLTNLAILDLYINQLSGELPLNLGKLSKLKFVALDFNLLEGALPPSLMNCTNLVELRLGTNNLEGNISMLDFSKLNQLAKLDLRVNNFTGTFPVSLYSCRSLKAIRLTGNNLAGQIQAQILSLKSLSFLSLGFNQFTNLTGAMKILMHCKSLHALMLSGSFKGEGMPADDDMVDFDGFQNLRVLCLVDSRLTGQLPVWLSKLQNLKILLLSGNEITGPIPSWLGTLPRLFYIKLSENRFSGEFPKQLCRLPRLVYEPNITSQVDDTSNEFELPFYFHTLARNPNYYLSSKISSYPATIDLSNNNIVGDIPIEVGQLQFLRGLVLHSNNFSGVIPDQISNLKNLEVLNLSMNHLSGIIPSSLASLTFLKEFNVSYNNLQGPIPTSTQLQSFNASAFEGNPKLCG

HMMPanther: PTHR24420:SF515
6-658 SUBFAMILY NOT NAMED

LLFLLFSCITSTNIHACKHTERSSLLSFASTVSSPPLNWTTSLDCCRWKGITCNQDGWVTHLLLPSKGLKGGLSTSSLGNLTHLTHLNLSHNSLYGSLENQFFLSLNRLELLDLSYNLLSGELPFSPPSSKIRTVDLSSNHFHGAIPSSFFQQASNLTSFNVSNNTFTGYVPSSICLHSSPFLRLLDFSSNLFNGNLAPGLGKCSKLQVFRAGHNNLSGLLPGDIYNATKLEEIAIPLSSLHGAISDKIVNLTNLAILDLYINQLSGELPLNLGKLSKLKFVALDFNLLEGALPPSLMNCTNLVELRLGTNNLEGNISMLDFSKLNQLAKLDLRVNNFTGTFPVSLYSCRSLKAIRLTGNNLAGQIQAQILSLKSLSFLSLGFNQFTNLTGAMKILMHCKSLHALMLSGSFKGEGMPADDDMVDFDGFQNLRVLCLVDSRLTGQLPVWLSKLQNLKILLLSGNEITGPIPSWLGTLPRLFYIKLSENRFSGEFPKQLCRLPRLVYEPNITSQVDDTSNEFELPFYFHTLARNPNYYLSSKISSYPATIDLSNNNIVGDIPIEVGQLQFLRGLVLHSNNFSGVIPDQISNLKNLEVLNLSMNHLSGIIPSSLASLTFLKEFNVSYNNLQGPIPTSTQLQSFNASAFEGNPKLCG

Gene3D: G3DSA:3.80.10.10
22-240 no description

CKHTERSSLLSFASTVSSPPLNWTTSLDCCRWKGITCNQDGWVTHLLLPSKGLKGGLSTSSLGNLTHLTHLNLSHNSLYGSLENQFFLSLNRLELLDLSYNLLSGELPFSPPSSKIRTVDLSSNHFHGAIPSSFFQQASNLTSFNVSNNTFTGYVPSSICLHSSPFLRLLDFSSNLFNGNLAPGLGKCSKLQVFRAGHNNLSGLLPGDIYNATKLEEIA

HMMPfam: PF08263
IPR013210
25-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TERSSLLSFASTVSSPPLNWTTSLDCCRWKGITCN

Seg: seg
28-39 seg

SSLLSFASTVSS

superfamily: SSF52058
42-320 L domain-like,LRR

LNWTTSLDCCRWKGITCNQDGWVTHLLLPSKGLKGGLSTSSLGNLTHLTHLNLSHNSLYGSLENQFFLSLNRLELLDLSYNLLSGELPFSPPSSKIRTVDLSSNHFHGAIPSSFFQQASNLTSFNVSNNTFTGYVPSSICLHSSPFLRLLDFSSNLFNGNLAPGLGKCSKLQVFRAGHNNLSGLLPGDIYNATKLEEIAIPLSSLHGAISDKIVNLTNLAILDLYINQLSGELPLNLGKLSKLKFVALDFNLLEGALPPSLMNCTNLVELRLGTNNLEG

Seg: seg
66-99 seg

HLLLPSKGLKGGLSTSSLGNLTHLTHLNLSHNSL

HMMSmart: SM00369
IPR003591
86-110 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTHLTHLNLSHNSLYGSLENQFFLS

HMMPfam: PF00560
IPR001611
88-109 LRR_1
Leucine-rich repeat

HLTHLNLSHNSLYGSLENQFFL

ProfileScan: PS51450
IPR001611
88-110 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTHLNLSHNSLYGSLENQFFLS

Seg: seg
109-128 seg

LSLNRLELLDLSYNLLSGEL

ProfileScan: PS51450
IPR001611
113-135 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLELLDLSYNLLSGELPFSPPSS

FPrintScan: PR00019
114-127 LEURICHRPT,Leucine-rich repeat signature

LELLDLSYNLLSGE

Gene3D: G3DSA:3.80.10.10
245-408 no description

SLHGAISDKIVNLTNLAILDLYINQLSGELPLNLGKLSKLKFVALDFNLLEGALPPSLMNCTNLVELRLGTNNLEGNISMLDFSKLNQLAKLDLRVNNFTGTFPVSLYSCRSLKAIRLTGNNLAGQIQAQILSLKSLSFLSLGFNQFTNLTGAMKILMHCKSLH

superfamily: SSF52058
245-654 L domain-like,LRR

SLHGAISDKIVNLTNLAILDLYINQLSGELPLNLGKLSKLKFVALDFNLLEGALPPSLMNCTNLVELRLGTNNLEGNISMLDFSKLNQLAKLDLRVNNFTGTFPVSLYSCRSLKAIRLTGNNLAGQIQAQILSLKSLSFLSLGFNQFTNLTGAMKILMHCKSLHALMLSGSFKGEGMPADDDMVDFDGFQNLRVLCLVDSRLTGQLPVWLSKLQNLKILLLSGNEITGPIPSWLGTLPRLFYIKLSENRFSGEFPKQLCRLPRLVYEPNITSQVDDTSNEFELPFYFHTLARNPNYYLSSKISSYPATIDLSNNNIVGDIPIEVGQLQFLRGLVLHSNNFSGVIPDQISNLKNLEVLNLSMNHLSGIIPSSLASLTFLKEFNVSYNNLQGPIPTSTQLQSFNASAFEGNP

HMMSmart: SM00369
IPR003591
257-281 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLAILDLYINQLSGELPLNLGKL

ProfileScan: PS51450
IPR001611
259-282 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLAILDLYINQLSGELPLNLGKLS

ProfileScan: PS51450
IPR001611
307-329 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVELRLGTNNLEGNISMLDFSK

Seg: seg
376-386 seg

LSLKSLSFLSL

HMMSmart: SM00369
IPR003591
378-400 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLSFLSLGFNQFTNLTGAMKI

ProfileScan: PS51450
IPR001611
380-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSFLSLGFNQFTNLTGAMKIL

HMMPfam: PF13855
435-494 LRR_8,Leucine rich repeat

NLRVLCLVDSRLTGQLPVWLSKLQNLKILLLSGNEITGPIPSWLGTLPRLFYIKLSENRF

Seg: seg
454-466 seg

LSKLQNLKILLLS

HMMSmart: SM00369
IPR003591
457-481 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQNLKILLLSGNEITGPIPSWLGTL

ProfileScan: PS51450
IPR001611
459-482 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKILLLSGNEITGPIPSWLGTLP

Gene3D: G3DSA:3.80.10.10
552-661 no description

TIDLSNNNIVGDIPIEVGQLQFLRGLVLHSNNFSGVIPDQISNLKNLEVLNLSMNHLSGIIPSSLASLTFLKEFNVSYNNLQGPIPTSTQLQSFNASAFEGNPKLCGAPL

HMMPfam: PF13855
574-632 LRR_8,Leucine rich repeat

LRGLVLHSNNFSGVIPDQISNLKNLEVLNLSMNHLSGIIPSSLASLTFLKEFNVSYNNL

FPrintScan: PR00019
595-608 LEURICHRPT,Leucine-rich repeat signature

LKNLEVLNLSMNHL

HMMSmart: SM00369
IPR003591
595-618 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLEVLNLSMNHLSGIIPSSLAS

ProfileScan: PS51450
IPR001611
597-618 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLNLSMNHLSGIIPSSLAS

ProfileScan: PS51450
IPR001611
621-643 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLKEFNVSYNNLQGPIPTSTQLQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox