PRGDB00172403 (ppa017338m)

From PRG Wiki
Revision as of 03:30, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa017338m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type NBS
Gene Species Prunus persica

Comment?

pleiotropic drug resistance 5 (best arabidopsis hit)

DNA Sequence

ATGGATTTGGCAGCAGAGATAGGAAGAAGCGTGAGGACCTCTTTTCATCAACATGCATCGAGTTTCAGGAGCACTTCAGACGTCAGATCCATCAACGACAACAACGACGACGAAACTGAGTTGCAGTGGGCTGCAATCCAACGGTTGCCCACATTTGAACGACTTACTGATGAGCAAGATAACAATGGAGGAGGTACTATTACTAAGAGGGTGGTTGATGTCACAAAGCTAGGAGCTCTCGAACGCCACGTGTTCATTGAGAAACTTGTCAAGGATATTGAGGGATATAACCGCCGTCTGTTGCAGAAACTCAAACAAAGAATAGACAGGGTGGGATTGCAATTACCGACTGTGGAAGTTGGATACCAAAATTTGGTTGTAGAGGCAGAATGCGAAGTGGTTCAAGGAAAACCCATCCCAACGCTATGGACCGCCCTCAAAAGCATACTCTGTGTAAGTCTTTCCTTATTATTATTATATAAAATATATATATTCATGTACATATTGCTAACCTGGCAATTGGCAATGCTTAACATGTGGATGAATCTTGGTATAACACAGATAATTGGTTGCAAGCCTCAAGCATACAAATTAGAGATTCTCAAAGGTGTCAGTGGCATCATCAAGCCATCAAGGATGACTCTATTGCTTGGCCCTCCAGGCTGTGGGAAGACCACTTTCTTACAGGCACTTGCTGGGAAACTTAACCACTCTCTCAAGGTCCGAGGAGAAATTACCTACAATGGTTACAAGTTCAATGAGTTTGTTCCTCAGAAGACATCAGCTTATATAAGTCAATATGACTTGCACATTCCTGAGCTGACTGTGAGGGAAGCACTCGACTTCTCAGCACGTTGCCAGGGTATTGGAAACAGAGCAGATATAATGAAAGAAGTCAGCAGAAGGGAGAAGCAATCAGGAATTGTCCCAGAACCAGACATTGACACTTATATGAAGGCCATTTCAATTGAAGGGTTGAAAAACTCCCTCCAGACTGACTATATAATGAAGATTCTTGGGCTAGACATTTGTGCTGATACAATCGTAGGCGACGCAATGCAAAGAGGAATTTCGGGTGGTCAGAAGAAAAGACTGACAACAGGGGAAATGATGATTGGTCCAGCAAGAGCTTTCTTCATGGATGAGATATCAACAGGCTTAGATAGTTCCACTACCCTTCAGATTGTTACTTGTTTGCAGCAACTGACACACGTAACAGACTCCACCATTTTGGTATCACTTCTTCAGCCAACACCGGAGACCTTCGCTCTCTTTGATGACATTATCTTGATAGGAAAAGTTGTGTATCATGGGCCTTGCAATAATGTTGCAGAGTTCTTTGAGCAGTGTGGTTTTCGCAGCCCACCGAGAAAAGGCATTTCTGACTTCCTGCAAGAGGTGGTTTCTCGAAAGGATCAGGCAAAGTACTGGTACCATGAAGACCAACCCTACAGTTATGTTACAGTTGACAAGTTTGTAAATATGTTCAAGGATTTTCATGTCGGAAAGAAGCTAGATGAGGAACTTCGCAAGCCTTTTGACAAATCTGAGTGCCACAAAGATGCTTTATCATTCAACATCTACTCATTAAGAAAATGGGAACTATTAAAAGCATGTACTGCTAGAGAATGGCTTCTTATGAAGCGCAACTCGTTTGTTCATGTGTTCAAGTCGGCACAGCTTGTCGTCGTTGCGCTAGTAACAATGACAGTTTTTTCACGTACATGGATGAATATTGACGATGTCCATGCAAAGTACTACATGGCTTCTTTGTTCTATGCTCTCATTAGACTGATGAGCAATGGGATTGCAGAGTTATCAATGACTGTCTCCAGACTTGCAGTCTTCTACAAGCAAAGAGATTTCTACTTTAATCCTGCATGGGCTTATTCCATTCCAGCTACCATTCTAAAGATTCCATTTTCATTGCTAGATGCTTTTCTTTGGACATCCCTTACTTATTATGTCATTGGTTACAGTCCTGAGCCCGAAAGGTTCTTCAAGCAAATCATTATTCTATTCCTTGTGCATCAAGTATCAATATCATTTTTTCGTCTGATCGCATCCTTGGTTCGAACTCCCTCTGTAGCAGCAACCATTGGTCTTTTCTCCTTAATAGTAATGTTTCTATTTGGTGGCTTCATAATTCCAAAATCTTCCTTGCCTACTTGGTTGGAGTGGGGCTTTTGGCTTTCTCCACTAACATATGGAGAAATAAGTGCTTCAGTAAATGAATTTCATGCTCCAAGGTGGCAAAAGGTTTTATCTTCAAATGTCACTATAGGCCAGCGAGTTCTGGGAAACCGTGGTCTCAATTTCAGTGACAGCTTTTATTGGATATCAATAGGAGCTTTACTTGGATTTTGGATGGTTTTCAACATTGGGTTCACCTGTGCACTCAGTTATTTAAAATGCATGGTCTTACCCTTTGAGCCCATAAGTATATCATTTCAGAATGTGCAATACTTTGTTGATACACCCAAGAAAATGAGAGAGCAAGGTTTTCCTCCACAACGACTACAGCTTCTTCAAGACATAACTGGTGCATTTAGACCTGGAATTCTTACAGCTTTGATGGGAGTTAGTGGAGCTGGAAAAACAACACTGATGGATGTCCTTTCTGGAAGAAAAACTGGTGGAAGTATTGAAGGAGACATTAGAATTGGAGGGTACCCAAAAGTACAAGAAACATATGCCAGAATATCTGGGTATTGTGAACAAAGTGACATACATTCTCCACAGATTACAGTAGGAGAATCTGTACAATACTCGGCTTGGTTACGCTTGCCAGCGCAGATTGATAGACATACAAGATCTCAATTTGTGAAAGAAGTTCTTCAAATGATAGAGCTTGATGAAATCAAAGACGAATTAGTTGGCATATCTGGTGGTAGTGGTATATCTGCAGAGCAACGCAAAAGGCTGACAATAGCAGTAGAGCTTGTTTCAAATCCATCCATAATATTCATGGACGAACCGACCTCTGGTTTAGATGCCAGAGCAGCTGCTATAGTTATGAGAGCTGTGAAAAATATTCTTATTTTGATGAAAAGAGGAGGACAAATAATATACTACGGAGAGCTAGGCCAAAATTCAAGTAAGCTTATTGAATACTTTGAGGGTATTCCCGGGGTTCCGAAAATTAAAGAGAATTACAACCCAGCAACATGGATGTTAGAGGTCACCGGTCTTTCTGCAGAAGCTCAAATTGCCATAGATTTTGCTCATATCTATAGAGGATCACATCTATGCCAGAAGAACAACGAACTAGTTAGAGAACTCAGCTTTCCAGAACAAGGCTCAAAGGAATTACATTTTTCTACTCGCTTTCCACAAAATGGATGGGAGCAATTCAAAGCATGCCTATGGAAGCGGCATCTCTCCTACTGGAGAAGTCCGAGATATAACCTGGGGAGATTGATATTTACTGCTGCATGTTCTTTGTTATTTGGAGCACTTCTTTGGCAGAAAGGACAGAAAATAGATGGCGAACAGGAATTTTTCAACATTCTAGGATCAATGTTTGTTTTACTTCAATGCATGGGAATTGGCAATTGTTCCTCTGTTTTACCATTCATAGCTACTGAGCGCAATGTTGTATACCGAGAAAGATTTGCTGGAATGTACTCGTCGTGGGCATATTCGTTTTCACAGGTGATCATAGAAATTCCATATATATTGATACAAGCAGCTTTGTTTTCGACAATTACGTATCCAGCCATAGATTTCCAATGGTCACTCTACAAAGTATTTTGGTATTTCTATGCTATGTTTTCTACATTCCTCTACTTCAATTACTTCGGTATGTTGCTTGTTTCTCTGACCCCAACTTATCAAGTGGCTTCAGTATTGGCAAGTTTCTGCTACACTATGTTCAATTTGTTCTCGGGTTTCCTCTTACCTGGACCAAAAATTCCTGTATGGTGGGTTTGGGGATACTGGATTTGCCCTCTTGCCTGGTCCTTAAAAGGTGCTCTCACTTCACAGTATGGAGATGTAGAGAAGGAAATAGTAGTGCATGGAGAGCAAAGGACAATCAGTGCCTTCTTGGGAAGTATTTATGGGTACAACTATGATGATCTAGGAGTTGTAGCAATTGTTCTTCTTGCATATCCACTAGTTTTTGCACTTGTTTTTGCATGTGCTACAGAAAAAATAAACTTTCAGAGGAGGTAA


Protein sequences

Name Description Sequence
ppa017338m pleiotropic drug resistance 5 (best arabidopsis hit)

MDLAAEIGRSVRTSFHQHASSFRSTSDVRSINDNNDDETELQWAAIQRLPTFERLTDEQDNNGGGTITKRVVDVTKLGALERHVFIEKLVKDIEGYNRRLLQKLKQRIDRVGLQLPTVEVGYQNLVVEAECEVVQGKPIPTLWTALKSILCVSLSLLLLYKIYIFMYILLTWQLAMLNMWMNLGITQIIGCKPQAYKLEILKGVSGIIKPSRMTLLLGPPGCGKTTFLQALAGKLNHSLKVRGEITYNGYKFNEFVPQKTSAYISQYDLHIPELTVREALDFSARCQGIGNRADIMKEVSRREKQSGIVPEPDIDTYMKAISIEGLKNSLQTDYIMKILGLDICADTIVGDAMQRGISGGQKKRLTTGEMMIGPARAFFMDEISTGLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVVYHGPCNNVAEFFEQCGFRSPPRKGISDFLQEVVSRKDQAKYWYHEDQPYSYVTVDKFVNMFKDFHVGKKLDEELRKPFDKSECHKDALSFNIYSLRKWELLKACTAREWLLMKRNSFVHVFKSAQLVVVALVTMTVFSRTWMNIDDVHAKYYMASLFYALIRLMSNGIAELSMTVSRLAVFYKQRDFYFNPAWAYSIPATILKIPFSLLDAFLWTSLTYYVIGYSPEPERFFKQIIILFLVHQVSISFFRLIASLVRTPSVAATIGLFSLIVMFLFGGFIIPKSSLPTWLEWGFWLSPLTYGEISASVNEFHAPRWQKVLSSNVTIGQRVLGNRGLNFSDSFYWISIGALLGFWMVFNIGFTCALSYLKCMVLPFEPISISFQNVQYFVDTPKKMREQGFPPQRLQLLQDITGAFRPGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNILILMKRGGQIIYYGELGQNSSKLIEYFEGIPGVPKIKENYNPATWMLEVTGLSAEAQIAIDFAHIYRGSHLCQKNNELVRELSFPEQGSKELHFSTRFPQNGWEQFKACLWKRHLSYWRSPRYNLGRLIFTAACSLLFGALLWQKGQKIDGEQEFFNILGSMFVLLQCMGIGNCSSVLPFIATERNVVYRERFAGMYSSWAYSFSQVIIEIPYILIQAALFSTITYPAIDFQWSLYKVFWYFYAMFSTFLYFNYFGMLLVSLTPTYQVASVLASFCYTMFNLFSGFLLPGPKIPVWWVWGYWICPLAWSLKGALTSQYGDVEKEIVVHGEQRTISAFLGSIYGYNYDDLGVVAIVLLAYPLVFALVFACATEKINFQRR*

Domains

Domain Start-End Description Sequence

Coil: coil
86-107 coiled-coil

IEKLVKDIEGYNRRLLQKLKQR

Seg: seg
146-164 seg

LKSILCVSLSLLLLYKIYI

ProfileScan: PS50893
IPR003439
174-456 ABC_TRANSPORTER_2
ABC transporter-like

LAMLNMWMNLGITQIIGCKPQAYKLEILKGVSGIIKPSRMTLLLGPPGCGKTTFLQALAGKLNHSLKVRGEITYNGYKFNEFVPQKTSAYISQYDLHIPELTVREALDFSARCQGIGNRADIMKEVSRREKQSGIVPEPDIDTYMKAISIEGLKNSLQTDYIMKILGLDICADTIVGDAMQRGISGGQKKRLTTGEMMIGPARAFFMDEISTGLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVVYHGPCNNVAEFFEQCGFRSPP

Gene3D: G3DSA:3.40.50.300
199-445 no description

EILKGVSGIIKPSRMTLLLGPPGCGKTTFLQALAGKLNHSLKVRGEITYNGYKFNEFVPQKTSAYISQYDLHIPELTVREALDFSARCQGIGNRADIMKEVSRREKQSGIVPEPDIDTYMKAISIEGLKNSLQTDYIMKILGLDICADTIVGDAMQRGISGGQKKRLTTGEMMIGPARAFFMDEISTGLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVVYHGPCNNVAE

superfamily: SSF52540
200-442 P-loop containing nucleoside triphosphate hydrolases

ILKGVSGIIKPSRMTLLLGPPGCGKTTFLQALAGKLNHSLKVRGEITYNGYKFNEFVPQKTSAYISQYDLHIPELTVREALDFSARCQGIGNRADIMKEVSRREKQSGIVPEPDIDTYMKAISIEGLKNSLQTDYIMKILGLDICADTIVGDAMQRGISGGQKKRLTTGEMMIGPARAFFMDEISTGLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVVYHGPCNN

HMMSmart: SM00382
IPR003593
210-435 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PSRMTLLLGPPGCGKTTFLQALAGKLNHSLKVRGEITYNGYKFNEFVPQKTSAYISQYDLHIPELTVREALDFSARCQGIGNRADIMKEVSRREKQSGIVPEPDIDTYMKAISIEGLKNSLQTDYIMKILGLDICADTIVGDAMQRGISGGQKKRLTTGEMMIGPARAFFMDEISTGLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVV

HMMPanther: PTHR19241:SF10
386-1391 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVVYHGPCNNVAEFFEQCGFRSPPRKGISDFLQEVVSRKDQAKYWYHEDQPYSYVTVDKFVNMFKDFHVGKKLDEELRKPFDKSECHKDALSFNIYSLRKWELLKACTAREWLLMKRNSFVHVFKSAQLVVVALVTMTVFSRTWMNIDDVHAKYYMASLFYALIRLMSNGIAELSMTVSRLAVFYKQRDFYFNPAWAYSIPATILKIPFSLLDAFLWTSLTYYVIGYSPEPERFFKQIIILFLVHQVSISFFRLIASLVRTPSVAATIGLFSLIVMFLFGGFIIPKSSLPTWLEWGFWLSPLTYGEISASVNEFHAPRWQKVLSSNVTIGQRVLGNRGLNFSDSFYWISIGALLGFWMVFNIGFTCALSYLKCMVLPFEPISISFQNVQYFVDTPKKMREQGFPPQRLQLLQDITGAFRPGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNILILMKRGGQIIYYGELGQNSSKLIEYFEGIPGVPKIKENYNPATWMLEVTGLSAEAQIAIDFAHIYRGSHLCQKNNELVRELSFPEQGSKELHFSTRFPQNGWEQFKACLWKRHLSYWRSPRYNLGRLIFTAACSLLFGALLWQKGQKIDGEQEFFNILGSMFVLLQCMGIGNCSSVLPFIATERNVVYRERFAGMYSSWAYSFSQVIIEIPYILIQAALFSTITYPAIDFQWSLYKVFWYFYAMFSTFLYFNYFGMLLVSLTPTYQVASVLASFCYTMFNLFSGFLLPGPKIPVWWVWGYWICPLAWSLKGALTSQYGDVEKEIVVHGEQRTISAFLGSIYGYNYDDLGVVAIVLLAYPLVFALVFACATEKINFQRR

HMMPanther: PTHR19241
386-1391 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTTLQIVTCLQQLTHVTDSTILVSLLQPTPETFALFDDIILIGKVVYHGPCNNVAEFFEQCGFRSPPRKGISDFLQEVVSRKDQAKYWYHEDQPYSYVTVDKFVNMFKDFHVGKKLDEELRKPFDKSECHKDALSFNIYSLRKWELLKACTAREWLLMKRNSFVHVFKSAQLVVVALVTMTVFSRTWMNIDDVHAKYYMASLFYALIRLMSNGIAELSMTVSRLAVFYKQRDFYFNPAWAYSIPATILKIPFSLLDAFLWTSLTYYVIGYSPEPERFFKQIIILFLVHQVSISFFRLIASLVRTPSVAATIGLFSLIVMFLFGGFIIPKSSLPTWLEWGFWLSPLTYGEISASVNEFHAPRWQKVLSSNVTIGQRVLGNRGLNFSDSFYWISIGALLGFWMVFNIGFTCALSYLKCMVLPFEPISISFQNVQYFVDTPKKMREQGFPPQRLQLLQDITGAFRPGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNILILMKRGGQIIYYGELGQNSSKLIEYFEGIPGVPKIKENYNPATWMLEVTGLSAEAQIAIDFAHIYRGSHLCQKNNELVRELSFPEQGSKELHFSTRFPQNGWEQFKACLWKRHLSYWRSPRYNLGRLIFTAACSLLFGALLWQKGQKIDGEQEFFNILGSMFVLLQCMGIGNCSSVLPFIATERNVVYRERFAGMYSSWAYSFSQVIIEIPYILIQAALFSTITYPAIDFQWSLYKVFWYFYAMFSTFLYFNYFGMLLVSLTPTYQVASVLASFCYTMFNLFSGFLLPGPKIPVWWVWGYWICPLAWSLKGALTSQYGDVEKEIVVHGEQRTISAFLGSIYGYNYDDLGVVAIVLLAYPLVFALVFACATEKINFQRR

HMMPfam: PF01061
IPR013525
535-745 ABC2_membrane
ABC-2 type transporter

LLKACTAREWLLMKRNSFVHVFKSAQLVVVALVTMTVFSRTWMNIDDVHAKYYMASLFYALIRLMSNGIAELSMTVSRLAVFYKQRDFYFNPAWAYSIPATILKIPFSLLDAFLWTSLTYYVIGYSPEPERFFKQIIILFLVHQVSISFFRLIASLVRTPSVAATIGLFSLIVMFLFGGFIIPKSSLPTWLEWGFWLSPLTYGEISASVNE

HMMPfam: PF08370
IPR013581
751-805 PDR_assoc
Plant PDR ABC transporter associated

WQKVLSSNVTIGQRVLGNRGLNFSDSFYWISIGALLGFWMVFNIGFTCALSYLKC

ProfileScan: PS50893
IPR003439
815-1069 ABC_TRANSPORTER_2
ABC transporter-like

ISFQNVQYFVDTPKKMREQGFPPQRLQLLQDITGAFRPGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNILILMKRGGQIIYYGELGQNSSKLIEYFEGIPGVPKIKENYNPATWMLEVTGLSAEAQ

Gene3D: G3DSA:3.40.50.300
815-1012 no description

ISFQNVQYFVDTPKKMREQGFPPQRLQLLQDITGAFRPGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNI

superfamily: SSF52540
842-1030 P-loop containing nucleoside triphosphate hydrolases

LLQDITGAFRPGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNILILMKRGGQIIYYGELGQ

HMMSmart: SM00382
IPR003593
852-1029 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGILTALMGVSGAGKTTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTSGLDARAAAIVMRAVKNILILMKRGGQIIYYGELG

HMMPfam: PF00005
IPR003439
867-995 ABC_tran
ABC transporter-like

TTLMDVLSGRKTGGSIEGDIRIGGYPKVQETYARISGYCEQSDIHSPQITVGESVQYSAWLRLPAQIDRHTRSQFVKEVLQMIELDEIKDELVGISGGSGISAEQRKRLTIAVELVSNPSIIFMDEPTS

HMMPfam: PF01061
IPR013525
1116-1329 ABC2_membrane
ABC-2 type transporter

EQFKACLWKRHLSYWRSPRYNLGRLIFTAACSLLFGALLWQKGQKIDGEQEFFNILGSMFVLLQCMGIGNCSSVLPFIATERNVVYRERFAGMYSSWAYSFSQVIIEIPYILIQAALFSTITYPAIDFQWSLYKVFWYFYAMFSTFLYFNYFGMLLVSLTPTYQVASVLASFCYTMFNLFSGFLLPGPKIPVWWVWGYWICPLAWSLKGALTSQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox