PRGDB00172416 (ppa008519m)

From PRG Wiki
Revision as of 03:30, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa008519m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

DNA Sequence

ATGGCGCTTCGTTTTTCGTTAGCAGCATTTTCTCTGATCCTCCTTCTATCCTATCCTCTGCTTCTCAACGCCAAAACCCTCAAACGTGACATGAAAGCATTGAACGAGATCAAGGCTTCGCTCGGATGGAGAGTCGTGTACGCTTGGGTCGGAGACGATCCTTGCGGAGACGGCGACCTTCCGCCGTGGTCCGGCGTCACTTGCTCCACTCAAGGCGATTATCGAGTTGTCACTGAGTTGGAGGTTTATGCAGTCTCAATTGTTGGCCCTTTTCCTACTGCTGTCACCAATCTCTTGGATCTCACTAGGCTGGATCTCCATAACAACAAGCTGACGGGCCCTATTCCCCCCCAAATTGGACGTTTGAAGCGTCTTAAAATGCTTAATTTGAGATGGAATAAGTTACAAGATGTCATTCCTCCTGAAATTGGTGAACTGAAGAGTTTAACCCATTTGCATCTAAGCTTTAATAGTTTCAAAGGGGAAATTCCAAAGGAGCTTGCTAATCTTCCAGAGCTTCGCTATCTCTATCTGCAAGAAAATCGTCTTGTTGGGCGGATTCCTGCAGAACTAGGAACTTTGCAAAATCTTCGGCACTTGGACGTTGGTAATAATCATTTGGTGGGTACCATTAGGGAACTCATACGTATCGAGGGCTGCTTTCCAGCTTTACGTAACCTTTACTTAAACAACAACTATCTTACGGGAGGAATTCCAGCACAGCTTGCAAACTTGACCAAGTTGGAAATCTTGTACCTATCTTACAACAAGATGTCTGGGATAGTTCCATTAGGACTTTCCCATATTCCGAGATTGACTTACTTGTATTTGGATCACAATCAATTTTCAGGGAGAATTCCCGATGCCTTCTATAAACACCCATTCTTGAAAGACATGTATATTGAAGGGAATGCATTCAGACCAGGTGTGAAACCGATAGGCATACACAAAGTTCTTGAGCTCACTGACACGGAATTTCTTGTTTAG


Protein sequences

Name Description Sequence
ppa008519m Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

MALRFSLAAFSLILLLSYPLLLNAKTLKRDMKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNSFKGEIPKELANLPELRYLYLQENRLVGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQFSGRIPDAFYKHPFLKDMYIEGNAFRPGVKPIGIHKVLELTDTEFLV*


Domains

Domain Start-End Description Sequence

Seg: seg
2-22 seg

ALRFSLAAFSLILLLSYPLLL

HMMPanther: PTHR24420:SF518
10-307 PROTEIN BINDING

FSLILLLSYPLLLNAKTLKRDMKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNSFKGEIPKELANLPELRYLYLQENRLVGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQFSGRIPDAFYKHPFLKDMYIEGNAFR

HMMPanther: PTHR24420
10-307 FAMILY NOT NAMED,FAMILY NOT NAMED

FSLILLLSYPLLLNAKTLKRDMKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNSFKGEIPKELANLPELRYLYLQENRLVGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQFSGRIPDAFYKHPFLKDMYIEGNAFR

superfamily: SSF52058
24-316 L domain-like,LRR

AKTLKRDMKALNEIKASLGWRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNSFKGEIPKELANLPELRYLYLQENRLVGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQFSGRIPDAFYKHPFLKDMYIEGNAFRPGVKPIGIH

Seg: seg
51-62 seg

GDDPCGDGDLPP

Gene3D: G3DSA:3.80.10.10
62-307 no description

PWSGVTCSTQGDYRVVTELEVYAVSIVGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNSFKGEIPKELANLPELRYLYLQENRLVGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRIEGCFPALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQFSGRIPDAFYKHPFLKDMYIEGNAFR

HMMSmart: SM00369
IPR003591
98-122 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLDLTRLDLHNNKLTGPIPPQIGRL

HMMPfam: PF00560
IPR001611
101-121 LRR_1
Leucine-rich repeat

LTRLDLHNNKLTGPIPPQIGR

HMMPfam: PF12799
123-160 LRR_4,Leucine Rich repeats (2 copies)

KRLKMLNLRWNKLQDVIPPEIGELKSLTHLHLSFNSFK

HMMSmart: SM00369
IPR003591
146-169 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLTHLHLSFNSFKGEIPKELAN

HMMSmart: SM00369
IPR003591
170-194 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPELRYLYLQENRLVGRIPAELGTL

HMMPfam: PF12799
171-207 LRR_4,Leucine Rich repeats (2 copies)

PELRYLYLQENRLVGRIPAELGTLQNLRHLDVGNNHL

HMMPfam: PF13855
222-281 LRR_8,Leucine rich repeat

PALRNLYLNNNYLTGGIPAQLANLTKLEILYLSYNKMSGIVPLGLSHIPRLTYLYLDHNQ

Seg: seg
224-234 seg

LRNLYLNNNYL

HMMSmart: SM00369
IPR003591
245-268 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKLEILYLSYNKMSGIVPLGLSH

HMMSmart: SM00369
IPR003591
269-293 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IPRLTYLYLDHNQFSGRIPDAFYKH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox