PRGDB00172435 (ppa019687m)

From PRG Wiki
Revision as of 03:28, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa019687m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCATATTGCTTCCTTCTCTTCCTCTTTTTCTCTTCCATTATTTCCACACATACTCATGCATGCAACCAAACTGATCGCAGCTCTCTCCTGTCCTTTACCCTAACTTTATCTTCTCTTCCTTTAAATTGGACCTCTGATAATTGTTGTCATTGGAAGGGCATCACTTGTGATCAAGATGGTAGGGTCACCCAATTGCTCTTACCCTACAAAGGGCTCAAAGGAGGTATGTTTCCCTCATCACTTGCAAATCTCACACATCTCACTCACTTGAATCTCTCCCACAATTCACTTTATGGTTCCCTTGAAACTCAGTTCTTTGTTTCCTTGAATCGTCTTCAGATCCTTGATTTGAGTTATAACCTTCTTTCTGGAGAGCTACCACTTTCTCTACCATCCAACAATATCCGGAAACTGGATTTGTCTAGCAATCACTTCTATGGGTACTGTTCCGAATTGAAGGTTTTTCAGGCCGGTCATAACAATCTCTCAGGATTACTTCCAGAAGATATCTATAATGCTTCTAAACTTGAAGAAATTGCATTGCCTCTAAATTCACTATATGGAGCCATTAGTGATAAAATTGTCAACCTCACCAACCTTGCAATCCTTGACCTCTACTTTAATCAATTGAGCGGTGCGCTTCCTGTCAATTTGGGGAGGCTCTCGAAGTTGAAGTTTGTGATCCTTGATTTCAACAATTTAGAAGGTTCTTTGCCCATCTCTTTGATGAATTGCACAAACCTTTTAGAACTTCATTTGGGATCCAACAACTTGGAAGGAGATATCTCCATGCTTGATTTCTCCAGACTTAGTCAACTTACTAAACTTGACCTAAGGGTTAATAACTTCACTGGTACGATTCCAGTAAGTCTTTACTCATGTAGGTCACTAAAAGCTATTGGATTGAGTGGAAATCATCTAGAGGGACAAATACAAGCTGAGATTCTTTCATTGAATTCCTTATCCTTCCTTTCGCTTGGTTACAACCGATTCACCAATGTCACAGGGGCAATGAAGATATTGATGAGTTGCAAAAGTCTTCACACACTCTCGCTTGCTGGTACCTTTGAAGGTGAGGGAATGCCATCTGATGATGACATGGTTGATTTTGACGGATTCAAAAATCTTCGGTTATTGAGTTTGGCTGATTCTGACTTCACTGGTCAAATACCTTTATGGTTATCAAAGCTCAAGAATCTAGAGATCTTAGCTCTATATAAAAATCAAATCACAGGACCAATTCCAAGTTGGTTGGGGACTCTTCCAAGACTTTTTTCTCTAAACTTGGCTAGTAACCGAATATCAGGTGAAATTCCAAAGCAACTTTGTAGACTACCAAGGTTGGTTTATGAACCTACTGCATCTCAAGTGGACAATTATGAATTTGAATTGCCTATCTTTGGCGGCAGTGTAATCGCAAATCCACGTTTTGAACCACACAAATTATTTTTGTTTTTTCCAGCGATTGACTTATCTAACAATAACATTAGTGGTGATATACCTACTGAGGTCGGCCAATTGCAGCTTCTCCGCAAGTTGAATCTTGACTCCAACAACTTTTTCGGTGTCATTCCAGATCAAATATCTAACCTAAAAAATTTAGAGCTTTTGAACCTCTCCAAGAACCACTTGTCTGGAACAATCCCATTGTCATTGGTGAGCCTCACTTTCTTGAAAGAATTTAATGTCTCGTACAATAATCTCCAGGGACCAATACCAACAGGCACTCAACTCCAAAGCTTCAACGCTTCTGCCTTTGAGGGGAATCCAAAACTTTGTGGTGCCCCACTTGCCAATAAGTGCAGTCGACCAAATAAAGGGATTGACGAAGATAACAAGAAGAACAACAAAGACATGGACAATGGGCTTCATCAAATTCCGTGGTTTTATATTTCTTCTGTTGTGCTAGGGTTTATAGTGGGATTTTGGGGAGTATGTGGTTCTTTAATTATTAACAAGACATGGAGATATGCATATTTTCGATTCATATACAAT


Protein sequences

Name Description Sequence
ppa019687m Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

MAYCFLLFLFFSSIISTHTHACNQTDRSSLLSFTLTLSSLPLNWTSDNCCHWKGITCDQDGRVTQLLLPYKGLKGGMFPSSLANLTHLTHLNLSHNSLYGSLETQFFVSLNRLQILDLSYNLLSGELPLSLPSNNIRKLDLSSNHFYGYCSELKVFQAGHNNLSGLLPEDIYNASKLEEIALPLNSLYGAISDKIVNLTNLAILDLYFNQLSGALPVNLGRLSKLKFVILDFNNLEGSLPISLMNCTNLLELHLGSNNLEGDISMLDFSRLSQLTKLDLRVNNFTGTIPVSLYSCRSLKAIGLSGNHLEGQIQAEILSLNSLSFLSLGYNRFTNVTGAMKILMSCKSLHTLSLAGTFEGEGMPSDDDMVDFDGFKNLRLLSLADSDFTGQIPLWLSKLKNLEILALYKNQITGPIPSWLGTLPRLFSLNLASNRISGEIPKQLCRLPRLVYEPTASQVDNYEFELPIFGGSVIANPRFEPHKLFLFFPAIDLSNNNISGDIPTEVGQLQLLRKLNLDSNNFFGVIPDQISNLKNLELLNLSKNHLSGTIPLSLVSLTFLKEFNVSYNNLQGPIPTGTQLQSFNASAFEGNPKLCGAPLANKCSRPNKGIDEDNKKNNKDMDNGLHQIPWFYISSVVLGFIVGFWGVCGSLIINKTWRYAYFRFIYN


Domains

Domain Start-End Description Sequence

Seg: seg
5-16 seg

FLLFLFFSSIIS

HMMPanther: PTHR24420:SF515
5-595 SUBFAMILY NOT NAMED

FLLFLFFSSIISTHTHACNQTDRSSLLSFTLTLSSLPLNWTSDNCCHWKGITCDQDGRVTQLLLPYKGLKGGMFPSSLANLTHLTHLNLSHNSLYGSLETQFFVSLNRLQILDLSYNLLSGELPLSLPSNNIRKLDLSSNHFYGYCSELKVFQAGHNNLSGLLPEDIYNASKLEEIALPLNSLYGAISDKIVNLTNLAILDLYFNQLSGALPVNLGRLSKLKFVILDFNNLEGSLPISLMNCTNLLELHLGSNNLEGDISMLDFSRLSQLTKLDLRVNNFTGTIPVSLYSCRSLKAIGLSGNHLEGQIQAEILSLNSLSFLSLGYNRFTNVTGAMKILMSCKSLHTLSLAGTFEGEGMPSDDDMVDFDGFKNLRLLSLADSDFTGQIPLWLSKLKNLEILALYKNQITGPIPSWLGTLPRLFSLNLASNRISGEIPKQLCRLPRLVYEPTASQVDNYEFELPIFGGSVIANPRFEPHKLFLFFPAIDLSNNNISGDIPTEVGQLQLLRKLNLDSNNFFGVIPDQISNLKNLELLNLSKNHLSGTIPLSLVSLTFLKEFNVSYNNLQGPIPTGTQLQSFNASAFEGNPKLCG

HMMPanther: PTHR24420
5-595 FAMILY NOT NAMED,FAMILY NOT NAMED

FLLFLFFSSIISTHTHACNQTDRSSLLSFTLTLSSLPLNWTSDNCCHWKGITCDQDGRVTQLLLPYKGLKGGMFPSSLANLTHLTHLNLSHNSLYGSLETQFFVSLNRLQILDLSYNLLSGELPLSLPSNNIRKLDLSSNHFYGYCSELKVFQAGHNNLSGLLPEDIYNASKLEEIALPLNSLYGAISDKIVNLTNLAILDLYFNQLSGALPVNLGRLSKLKFVILDFNNLEGSLPISLMNCTNLLELHLGSNNLEGDISMLDFSRLSQLTKLDLRVNNFTGTIPVSLYSCRSLKAIGLSGNHLEGQIQAEILSLNSLSFLSLGYNRFTNVTGAMKILMSCKSLHTLSLAGTFEGEGMPSDDDMVDFDGFKNLRLLSLADSDFTGQIPLWLSKLKNLEILALYKNQITGPIPSWLGTLPRLFSLNLASNRISGEIPKQLCRLPRLVYEPTASQVDNYEFELPIFGGSVIANPRFEPHKLFLFFPAIDLSNNNISGDIPTEVGQLQLLRKLNLDSNNFFGVIPDQISNLKNLELLNLSKNHLSGTIPLSLVSLTFLKEFNVSYNNLQGPIPTGTQLQSFNASAFEGNPKLCG

HMMPfam: PF08263
IPR013210
24-58 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QTDRSSLLSFTLTLSSLPLNWTSDNCCHWKGITCD

Seg: seg
28-40 seg

SSLLSFTLTLSSL

Gene3D: G3DSA:3.80.10.10
28-252 no description

SSLLSFTLTLSSLPLNWTSDNCCHWKGITCDQDGRVTQLLLPYKGLKGGMFPSSLANLTHLTHLNLSHNSLYGSLETQFFVSLNRLQILDLSYNLLSGELPLSLPSNNIRKLDLSSNHFYGYCSELKVFQAGHNNLSGLLPEDIYNASKLEEIALPLNSLYGAISDKIVNLTNLAILDLYFNQLSGALPVNLGRLSKLKFVILDFNNLEGSLPISLMNCTNLLEL

superfamily: SSF52047
65-333 RNI-like,LRR

QLLLPYKGLKGGMFPSSLANLTHLTHLNLSHNSLYGSLETQFFVSLNRLQILDLSYNLLSGELPLSLPSNNIRKLDLSSNHFYGYCSELKVFQAGHNNLSGLLPEDIYNASKLEEIALPLNSLYGAISDKIVNLTNLAILDLYFNQLSGALPVNLGRLSKLKFVILDFNNLEGSLPISLMNCTNLLELHLGSNNLEGDISMLDFSRLSQLTKLDLRVNNFTGTIPVSLYSCRSLKAIGLSGNHLEGQIQAEILSLNSLSFLSLGYNRFT

HMMPfam: PF13855
79-123 LRR_8,Leucine rich repeat

PSSLANLTHLTHLNLSHNSLYGSLETQFFVSLNRLQILDLSYNLL

Seg: seg
80-98 seg

SSLANLTHLTHLNLSHNSL

HMMSmart: SM00369
IPR003591
85-109 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTHLTHLNLSHNSLYGSLETQFFVS

HMMSmart: SM00369
IPR003591
110-134 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LNRLQILDLSYNLLSGELPLSLPSN

FPrintScan: PR00019
113-126 LEURICHRPT,Leucine-rich repeat signature

LQILDLSYNLLSGE

Seg: seg
121-135 seg

NLLSGELPLSLPSNN

HMMSmart: SM00369
IPR003591
198-222 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLAILDLYFNQLSGALPVNLGRL

HMMPfam: PF13855
223-283 LRR_8,Leucine rich repeat

SKLKFVILDFNNLEGSLPISLMNCTNLLELHLGSNNLEGDISMLDFSRLSQLTKLDLRVNN

superfamily: SSF52058
245-586 L domain-like,LRR

NCTNLLELHLGSNNLEGDISMLDFSRLSQLTKLDLRVNNFTGTIPVSLYSCRSLKAIGLSGNHLEGQIQAEILSLNSLSFLSLGYNRFTNVTGAMKILMSCKSLHTLSLAGTFEGEGMPSDDDMVDFDGFKNLRLLSLADSDFTGQIPLWLSKLKNLEILALYKNQITGPIPSWLGTLPRLFSLNLASNRISGEIPKQLCRLPRLVYEPTASQVDNYEFELPIFGGSVIANPRFEPHKLFLFFPAIDLSNNNISGDIPTEVGQLQLLRKLNLDSNNFFGVIPDQISNLKNLELLNLSKNHLSGTIPLSLVSLTFLKEFNVSYNNLQGPIPTGTQLQSFNASA

Gene3D: G3DSA:3.80.10.10
253-355 no description

HLGSNNLEGDISMLDFSRLSQLTKLDLRVNNFTGTIPVSLYSCRSLKAIGLSGNHLEGQIQAEILSLNSLSFLSLGYNRFTNVTGAMKILMSCKSLHTLSLAG

HMMSmart: SM00369
IPR003591
271-295 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSQLTKLDLRVNNFTGTIPVSLYSC

Seg: seg
317-327 seg

LSLNSLSFLSL

HMMPfam: PF13516
422-444 LRR_6,Leucine Rich repeat

LPRLFSLNLASNRISGEIPKQLC

HMMSmart: SM00369
IPR003591
422-446 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPRLFSLNLASNRISGEIPKQLCRL

Gene3D: G3DSA:3.80.10.10
489-598 no description

AIDLSNNNISGDIPTEVGQLQLLRKLNLDSNNFFGVIPDQISNLKNLELLNLSKNHLSGTIPLSLVSLTFLKEFNVSYNNLQGPIPTGTQLQSFNASAFEGNPKLCGAPL

HMMSmart: SM00369
IPR003591
508-531 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQLLRKLNLDSNNFFGVIPDQISN

HMMPfam: PF00560
IPR001611
511-532 LRR_1
Leucine-rich repeat

LRKLNLDSNNFFGVIPDQISNL

Seg: seg
530-546 seg

SNLKNLELLNLSKNHLS

FPrintScan: PR00019
532-545 LEURICHRPT,Leucine-rich repeat signature

LKNLELLNLSKNHL

HMMSmart: SM00369
IPR003591
532-556 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLELLNLSKNHLSGTIPLSLVSL

HMMPfam: PF00560
IPR001611
534-555 LRR_1
Leucine-rich repeat

NLELLNLSKNHLSGTIPLSLVS

Seg: seg
606-622 seg

NKGIDEDNKKNNKDMDN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox