PRGDB00172462 (ppa026003m)

From PRG Wiki
Revision as of 03:27, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa026003m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGCTCTTGTGAGAGCATCCGATCCACAAACCTCCTCTGTTTCCAGTGCTTCTCGATATTGTCGTTATCACGTGTTCCTGAGTTTCAAAGGCCAAGACACTCGCAAGACTTTCACTGACCACCTCTACACGGCCCTTGTCAACGCTGGATTTCGCACTTTCCGAGACGACGACGAAGTCGAGAGAGGAGAAGCTATCAAGCCCGAACTGCAGAAAGCAATCAAACACTCACGAACTTCTGTTATTGTGTTCTCAAAAAACTACGCATCGTCCAGATGGTGTCTTGACGAGCTCGTCATGATCCTTGAACGGCTCTCAGCTGACCATGTCGTTTTACCTGTCTTCTACGACGTGGATCCATCCGATGTGCGGAACCAGACAGGAAGTCTTGCAAAGGCATTTGCTAGACACCAAAAAACCCAACCGTCGAACAAAGTGAAGGAATGGAGGGAGGCACTTGCAGAGGTTGCAGATCTGGCAGGGATGGTCTTACCAAATCAAGCTAATGGACGTGACTCAAAGTTTATCAATAAGATTGTTCAAGTGATAGGAGAAAAACTAAGGCGTAGACCCCTAAGTGTTCCCCACATCATGATCGGAATGCATTCTCGAGTCAACGAACTTAACTTATGGTTACAAGATGGATCAGATGATGTCGGTATACTTGTAATTTATGGCATGAGTGGAATAGGGAAGACAACCATTGCAAAGTCTCTTCATAATACAAACTTTGGAAGATTTGAAGGAAGTAGCTTCATCGAAAACATTAGAGAAATTTCACAACAACCCAATGGCTTAGTTCAAATACAAAAACAATTTCTTTCTGACATTTTGAATGGGAGAAAAATGAAAATAAGCAGTGTTAGTGAGGGATTAATTAAGATTGAAGATGCAATAAGCTCTAAAAGGGTTCTTCTTGTTCTCGATGATGTGGATCATATAGACCAATTAGATGCAGTATTTCAAAGGAAAGATCGATTTTATCCGAGAAGTAAAATCATCATAACAACTAGGCGTGCAAGATTGTTAAAGGCTCGTCAAGTTACTAAGGTGTATGCAGTTGGAACTTTGACTCAAAAAGAATCATTGGAGCTCTTCAGTTGGCACGCTTTTGGCCAAGACCATCCTATTGAAGATTACATAGAATATTCAGAGAAGCTAGTCGATCATTGCGGAGGACTTCCATTAGCTCTCAAAGTTTTAGGTTCTTCTTTGTTGGGGGAAAGTACATGTCTATGGAAAAGTGCATTGGAGAAGTTAGAAGCTATTCCAAATGGTGAAATAATAAATAAACTAAGAGTAAGCTATGACTCTTTGCAAGATGACCATGACCGAAATTTATTCCTCCACATTGCTTGTTTTTTTATCGGAATGGACAAAGATTATTCCTCCACCATGACCGAAAATACTGGATGGATATGTTTGGTGACAATAGTTGATGGATGGGACAAGGTACAGATGCACGACCTGATTCGTGGAATGGGAACAGAAATTGTTCGCCTAGAATCAAATGAGCCTTGGAAGCGTAGTAGAGTATTGCATCATAAGGACTCTTTCAAAATCTTGACGGAAAAGAATGGTACAGAAACAATTGAAGGTCTTGTCCTCGACATGCAAATGTGCCCTACTATAAACTCAAATGAGAAAGTCTTGGAAACCAATGCATTTTCAAGGATGCGGGAACTAAAACTACTCCATCTTAGTCATGTACAACTTAACGGATCTTATGCAGAATTTTGTACAGGACTAATATGGTTGTGTTGGACTAAGTTTCCTTTGGATTCTATACCCGTTGATTTTCCTTTGGAAAGCGTTATTATTCTTGAAATGCAATACAGCGGTCTGAGACAAGTATTCAAGGGAACAAAATATCTTCCATCCTTGAAGATCCTTGATCTCAACCATTCTCATTCCCTTACAGAAACCATTGACTTCTCATATTGCCCAAATCTAGAGAAATTGGTTCTAGTAGACTGTACAAGCCTGATTTATGTCCATGGATCCATTGGAAACCTAGAGAGACTTATTTACTTGAATATGAAAGATTGCAAAAACCTTAGGATGCTTCCCAAGAACATTTGTATGCTAAAATCACTTGAAACATTTATTATATCTGGTTGCTCAAATCTTAGTGAGTTATCAACTGAGATGTTGAGGAATATGGACGCGTTAAAAGTGCTTGAGACAGATGGAATTCCGATAAGTGAATTATGGCTAGAAAAAAGTTCGAGTATCTTGGGTTCTTTACCATGCGCTCTAATGGAATTAAGTCTTTGGGGTTGCAATCTTTCGGATGATGCACTTCCTATGGATTTTAGTAATTTGTCCTCATTGCAGAGACTAAATCTAGGGAATAATCCAATTAGTAGCCTACCAAATTGTATCAAAGGATTAACAAGGCTCCATACACTCTCTTTAAATGAGTGTACGATTCTCAAATCGCTTCTGGGGTTACCAAAACTAAAGGACTTGCATATCTTAAATTGCACATCATTGGAGAAAATAACATATCAATCTTCTTCGTCAGTGTCATGCACATATGGTTACAACCACAACCTAGTTGAGTGGCAGTACAAGTACAAGTTACAACCCATTGGAAGTGTAGATGGACTGTACGAACATGGTATATTCAGCACAGTTTTTGGTGGGAATAAGGTTCCAGGCAAATTCAGCCATAAAAGCAGAGGGTCCTCAATATCTTTTACTGTGCCATTACTTGATAATCACAGAACTCGAGGCTTGATTGTCTTTGTTGTCTATGTGAATGCTGGCTATGATTCTCCTCCTATTATCCACCACAATTATTTGTCACAAATAATAGTAAAAAATAAGAGCAACGGTCTGAGGGGGCGGTATTGCCCATCACGCTACGGTATTCCAGGTGAAGGAGAAGACATGATATGGTTAAGCCACTGGAATTTGGAGGATGATCAGTTACAAGGTGGCGATGAAGTGGTTGTTTCTGTAATTATGAAATCTGGGCTTCTGGTAAAGGAGTTGGGCATCCGACTTGTGCAGATGCAACAAGAAGAGAATCATAATATGATGATTTTTACCCTTTTAAATATTGCTCCTCTCCTGAAAAATTCATGTTTAAGTTTCAAGCCCACTTAG


Protein sequences

Name Description Sequence
ppa026003m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MALVRASDPQTSSVSSASRYCRYHVFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEVADLAGMVLPNQANGRDSKFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELNLWLQDGSDDVGILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQIQKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYPRSKIIITTRRARLLKARQVTKVYAVGTLTQKESLELFSWHAFGQDHPIEDYIEYSEKLVDHCGGLPLALKVLGSSLLGESTCLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRNLFLHIACFFIGMDKDYSSTMTENTGWICLVTIVDGWDKVQMHDLIRGMGTEIVRLESNEPWKRSRVLHHKDSFKILTEKNGTETIEGLVLDMQMCPTINSNEKVLETNAFSRMRELKLLHLSHVQLNGSYAEFCTGLIWLCWTKFPLDSIPVDFPLESVIILEMQYSGLRQVFKGTKYLPSLKILDLNHSHSLTETIDFSYCPNLEKLVLVDCTSLIYVHGSIGNLERLIYLNMKDCKNLRMLPKNICMLKSLETFIISGCSNLSELSTEMLRNMDALKVLETDGIPISELWLEKSSSILGSLPCALMELSLWGCNLSDDALPMDFSNLSSLQRLNLGNNPISSLPNCIKGLTRLHTLSLNECTILKSLLGLPKLKDLHILNCTSLEKITYQSSSSVSCTYGYNHNLVEWQYKYKLQPIGSVDGLYEHGIFSTVFGGNKVPGKFSHKSRGSSISFTVPLLDNHRTRGLIVFVVYVNAGYDSPPIIHHNYLSQIIVKNKSNGLRGRYCPSRYGIPGEGEDMIWLSHWNLEDDQLQGGDEVVVSVIMKSGLLVKELGIRLVQMQQEENHNMMIFTLLNIAPLLKNSCLSFKPT*

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
11-162 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

TSSVSSASRYCRYHVFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEVADLAGM

ProfileScan: PS50104
IPR000157
21-159 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CRYHVFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEVADL

Gene3D: G3DSA:3.40.50.10140
21-156 no description

CRYHVFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEV

HMMSmart: SM00255
IPR000157
22-159 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RYHVFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEVADL

HMMPfam: PF01582
IPR000157
25-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALA

HMMPanther: PTHR11017
47-899 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEVADLAGMVLPNQANGRDSKFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELNLWLQDGSDDVGILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQIQKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYPRSKIIITTRRARLLKARQVTKVYAVGTLTQKESLELFSWHAFGQDHPIEDYIEYSEKLVDHCGGLPLALKVLGSSLLGESTCLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRNLFLHIACFFIGMDKDYSSTMTENTGWICLVTIVDGWDKVQMHDLIRGMGTEIVRLESNEPWKRSRVLHHKDSFKILTEKNGTETIEGLVLDMQMCPTINSNEKVLETNAFSRMRELKLLHLSHVQLNGSYAEFCTGLIWLCWTKFPLDSIPVDFPLESVIILEMQYSGLRQVFKGTKYLPSLKILDLNHSHSLTETIDFSYCPNLEKLVLVDCTSLIYVHGSIGNLERLIYLNMKDCKNLRMLPKNICMLKSLETFIISGCSNLSELSTEMLRNMDALKVLETDGIPISELWLEKSSSILGSLPCALMELSLWGCNLSDDALPMDFSNLSSLQRLNLGNNPISSLPNCIKGLTRLHTLSLNECTILKSLLGLPKLKDLHILNCTSLEKITYQSSSSVSCTYGYNHNLVEWQYKYKLQPIGSVDGLYEHGIFSTVFGGNKVPGKFSHKSRGSSI

HMMPanther: PTHR11017:SF20
47-899 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VNAGFRTFRDDDEVERGEAIKPELQKAIKHSRTSVIVFSKNYASSRWCLDELVMILERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQPSNKVKEWREALAEVADLAGMVLPNQANGRDSKFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELNLWLQDGSDDVGILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQIQKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYPRSKIIITTRRARLLKARQVTKVYAVGTLTQKESLELFSWHAFGQDHPIEDYIEYSEKLVDHCGGLPLALKVLGSSLLGESTCLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRNLFLHIACFFIGMDKDYSSTMTENTGWICLVTIVDGWDKVQMHDLIRGMGTEIVRLESNEPWKRSRVLHHKDSFKILTEKNGTETIEGLVLDMQMCPTINSNEKVLETNAFSRMRELKLLHLSHVQLNGSYAEFCTGLIWLCWTKFPLDSIPVDFPLESVIILEMQYSGLRQVFKGTKYLPSLKILDLNHSHSLTETIDFSYCPNLEKLVLVDCTSLIYVHGSIGNLERLIYLNMKDCKNLRMLPKNICMLKSLETFIISGCSNLSELSTEMLRNMDALKVLETDGIPISELWLEKSSSILGSLPCALMELSLWGCNLSDDALPMDFSNLSSLQRLNLGNNPISSLPNCIKGLTRLHTLSLNECTILKSLLGLPKLKDLHILNCTSLEKITYQSSSSVSCTYGYNHNLVEWQYKYKLQPIGSVDGLYEHGIFSTVFGGNKVPGKFSHKSRGSSI

superfamily: SSF52540
181-428 P-loop containing nucleoside triphosphate hydrolases

QVIGEKLRRRPLSVPHIMIGMHSRVNELNLWLQDGSDDVGILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQIQKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYPRSKIIITTRRARLLKARQVTKVYAVGTLTQKESLELFSWHAFGQDHPIEDYIEYSEKLVDHCGGLPLALKVLGSSLLGESTCLWKSALEKLEAIPNGEI

HMMPfam: PF00931
IPR002182
204-460 NB-ARC,NBS
NB-ARC

RVNELNLWLQDGSDDVGILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQIQKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYPRSKIIITTRRARLLKARQVTKVYAVGTLTQKESLELFSWHAFGQDHPIEDYIEYSEKLVDHCGGLPLALKVLGSSLLGESTCLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRNLFLHIACFFIGMDK

Gene3D: G3DSA:3.40.50.300
221-346 no description

ILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQIQKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYPRSKIIITTRRARLLKAR

FPrintScan: PR00364
IPR000767
221-236 DISEASERSIST
Disease resistance protein

ILVIYGMSGIGKTTIA

FPrintScan: PR00364
IPR000767
298-312 DISEASERSIST
Disease resistance protein

AISSKRVLLVLDDVD

Seg: seg
304-320 seg

VLLVLDDVDHIDQLDAV

FPrintScan: PR00364
IPR000767
391-405 DISEASERSIST
Disease resistance protein

CGGLPLALKVLGSSL

superfamily: SSF52058
486-836 L domain-like,LRR

QMHDLIRGMGTEIVRLESNEPWKRSRVLHHKDSFKILTEKNGTETIEGLVLDMQMCPTINSNEKVLETNAFSRMRELKLLHLSHVQLNGSYAEFCTGLIWLCWTKFPLDSIPVDFPLESVIILEMQYSGLRQVFKGTKYLPSLKILDLNHSHSLTETIDFSYCPNLEKLVLVDCTSLIYVHGSIGNLERLIYLNMKDCKNLRMLPKNICMLKSLETFIISGCSNLSELSTEMLRNMDALKVLETDGIPISELWLEKSSSILGSLPCALMELSLWGCNLSDDALPMDFSNLSSLQRLNLGNNPISSLPNCIKGLTRLHTLSLNECTILKSLLGLPKLKDLHILNCTSLEKIT

Gene3D: G3DSA:3.80.10.10
616-835 no description

RQVFKGTKYLPSLKILDLNHSHSLTETIDFSYCPNLEKLVLVDCTSLIYVHGSIGNLERLIYLNMKDCKNLRMLPKNICMLKSLETFIISGCSNLSELSTEMLRNMDALKVLETDGIPISELWLEKSSSILGSLPCALMELSLWGCNLSDDALPMDFSNLSSLQRLNLGNNPISSLPNCIKGLTRLHTLSLNECTILKSLLGLPKLKDLHILNCTSLEKI

FPrintScan: PR00364
IPR000767
623-639 DISEASERSIST
Disease resistance protein

KYLPSLKILDLNHSHSL

ProfileScan: PS51450
IPR001611
627-649 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILDLNHSHSLTETIDFSYCP

HMMPfam: PF12799
753-793 LRR_4,Leucine Rich repeats (2 copies)

LMELSLWGCNLSDDALPMDFSNLSSLQRLNLGNNPISSLPN

ProfileScan: PS51450
IPR001611
777-799 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQRLNLGNNPISSLPNCIKGLT

ProfileScan: PS51450
IPR001611
800-822 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLHTLSLNECTILKSLLGLPKLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox