PRGDB00172506 (ppa001414m)

From PRG Wiki
Revision as of 03:26, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa001414m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

S-locus lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGTTCATGTTGGTGTTGGTGCGGCTCCTTCTTCTGCAGCTCTGCTCTTCTTTGGACACCATCAGTTTTGATCAATCTATCAGAGATGGTGATTTCTTGGTGTCTAAGAATGAGACCTTTGTGCTTGGTTTCTTCAGACCTGGCACATCTAGCAACCGCTATGTTGGAATTTGGTACAAGTTCTCAGAGGACAAGGTTTTGTGGGTAGCTAACAGAGACAACCCTCTCAATGATACCTCTGGAGTTCTCTCAATCAACACTGATGGAAATCTCATACTAGCTCATGGTAATAGCAGTCAAGGCCTTCCTCTGTGGTCAACAAATGTTTCTGTCTCATCATCGGGTAACAACAATATTGTAGCACAGCTCCTGGATTCAGGAAATTTTGTTTTGGTTCAACAAGACAACCAGAATGTTTTATGGCAAAGCTCTGATCATCCTACACATGCTCTTCTCTCAAGTATGAAACTTGGGTTGGACAAAAAAAGCGGTATCAACCGGTTCCTCACATCTTGGAACTCGAACAATGATCCCGGAACTGGGAATTGTTCATTACGAATGGACACAAATGGCTCACCACAGTTGATCTTGTACAAGAATCTAGCTAAGTGGTGGAGGTCAGGTCAATGGAATGGGATTCAATGGGGTGGCATACCGGCTGAGGGCAGCAACAATGTGTTTAAGATCAATTTTGTGAACAACCAAGATGAAATTGCTGTTGAATGGTCTGTTCTTGACCCTTCAATTTACTCAGTGATAACCATAGATGGGACAGGATCACTCAACCAGCTATCATGGCAGGGGCAGCAGCACCAGTGGGTTACCCTTTGGTCAGCACCATTGGATGCTTGTGACAGCTATGGCAAGTGTGGTCAATTTGGTGCTTGCAATCCTTACACTAACAGTGGGTTCAACTGCACATGCTACCCTGGCTATGAACCCAACTCGCCACACGATTGGGATTTGAGAGATGGGACGGGTGGGTGCAAGAGGCCTCAGGGGTCACCATCCATGTGTAGGAATGGTGAAGGGTTTGTGAAGATGGAAAATGTTAAGGTTCCAGATACTTCCACAATAAAATTGAACAGGAGTTTGAGTTTCGAAGCATGTGGGGAAGAGTGCTTGAGAAACTGCTCTTGCTTGGCTTATGCCAGTGCAGATGTGAGGAATGGAGGGAGTGGATGCATGGCATGGTTTGGAGATTTAATGGATACTAAGCAGTTCACAGAAGGGGGGCAAGATTTGTACATTCGTGCTGATGCGCTTGTGTTAGCTCAGTATACAAAGAAGTCAGGAGGAGGGTTCTCTGCCAAAGATAGGAGACTGGCTATTATATTAGGAGTGTCTATTGCTGTTACATCATTGCTTATTGTCGCTGCGTTATGTTGGTTTAGGAGAAGGAGCAGGAAAGGGAGAGGAGGACAACCCGAATTGCTGAATGATGCCATTGCTGGTTCGAGAAGCCATGAAGATCTACTGAAGAAAAATGAGGTTGATGAACACAGAGGAAAAACGGATTTACCTTTCTTTGATCTAAGCACGATAGTTGCGGCCACGGACAACTTCTCTTCTGCTAACTTGCTTGGACATGGTGGCTTTGGCATGGTGTTTAAGGGATGTCTAGCTGATGGACAGGAAATAGCTGTCAAAAGATTATCAAGAAATTCAGGACAAGGCGTCGAAGAATTCAAGAATGAAGTAATGCTTATAGCAAAACTCCAGCATAGAAATCTTGTGAGGCTTTTGGGTTGCTGCATAGATAAAGAAGAGAGGATGCTAATCTACGAGTACATGCCAAACCGCAGCTTGGACTTGTGCATTTTTGACAAAAGCAGAAGGTCATTGTTGGATTGGAGAAAGCGGTTTCAAATTATCATCGGGATTGCTCGGGGCGTCCTATATCTTCATCAAGATTCAAGACTAAAAATTATCCATAGGGATTTGAAAGCAAGCAATGTTTTACTGGATGCCTCAATGAACCCAAAAATATCAGATTTCGGCATGGCAAGAATGTTCGGGGATGACCAGATCGAAGCAAACACAAACAGAGTTGTTGGCACATATGGTTACATGTCACCTGAGTATGCTATGGATGGGCTATATTCCACAAAATCTGATGTCTTTAGCTTTGGAGTCTTAGCACTAGAGATCATTAGTGGCAGGAAGAACAATTTCCATTTTGAAAATTCCTCTCTGAATTTGGTTGGACAAATGTGGGACTTGTGGGTTGAAGGAAAAGCCTTGGACACAGTTGATCCGTCGTTGAGTAGGTCATATTCTACTCATGAAGTTATGAGATGCATTCAAATTGGGCTCTTGTGTGTGCAAGAATATGCAACAGATAGGCCAACCATGTTAGATGTTGTATTTATGCTGGGGAATGAAACTAGTCTTCCACCTCCTAAAAAGGCAGCATTTAGTTTCAAAAATAGTGGCCGGGATTCTTCAACATCTAGAGGAGCTTCTTCTGTAAATGATGTAACAGTCACAGTTATTGAAGCTCGTTAA


Protein sequences

Name Description Sequence
ppa001414m S-locus lectin protein kinase family protein (best arabidopsis hit)

MFMLVLVRLLLLQLCSSLDTISFDQSIRDGDFLVSKNETFVLGFFRPGTSSNRYVGIWYKFSEDKVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSSDHPTHALLSSMKLGLDKKSGINRFLTSWNSNNDPGTGNCSLRMDTNGSPQLILYKNLAKWWRSGQWNGIQWGGIPAEGSNNVFKINFVNNQDEIAVEWSVLDPSIYSVITIDGTGSLNQLSWQGQQHQWVTLWSAPLDACDSYGKCGQFGACNPYTNSGFNCTCYPGYEPNSPHDWDLRDGTGGCKRPQGSPSMCRNGEGFVKMENVKVPDTSTIKLNRSLSFEACGEECLRNCSCLAYASADVRNGGSGCMAWFGDLMDTKQFTEGGQDLYIRADALVLAQYTKKSGGGFSAKDRRLAIILGVSIAVTSLLIVAALCWFRRRSRKGRGGQPELLNDAIAGSRSHEDLLKKNEVDEHRGKTDLPFFDLSTIVAATDNFSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFMLGNETSLPPPKKAAFSFKNSGRDSSTSRGASSVNDVTVTVIEAR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF432
1-835 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MFMLVLVRLLLLQLCSSLDTISFDQSIRDGDFLVSKNETFVLGFFRPGTSSNRYVGIWYKFSEDKVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSSDHPTHALLSSMKLGLDKKSGINRFLTSWNSNNDPGTGNCSLRMDTNGSPQLILYKNLAKWWRSGQWNGIQWGGIPAEGSNNVFKINFVNNQDEIAVEWSVLDPSIYSVITIDGTGSLNQLSWQGQQHQWVTLWSAPLDACDSYGKCGQFGACNPYTNSGFNCTCYPGYEPNSPHDWDLRDGTGGCKRPQGSPSMCRNGEGFVKMENVKVPDTSTIKLNRSLSFEACGEECLRNCSCLAYASADVRNGGSGCMAWFGDLMDTKQFTEGGQDLYIRADALVLAQYTKKSGGGFSAKDRRLAIILGVSIAVTSLLIVAALCWFRRRSRKGRGGQPELLNDAIAGSRSHEDLLKKNEVDEHRGKTDLPFFDLSTIVAATDNFSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFMLGNETSLPPPKKAAFSFKNSGRDSSTSRGASSVNDVTVTVIEAR

HMMPanther: PTHR24420
1-835 FAMILY NOT NAMED,FAMILY NOT NAMED

MFMLVLVRLLLLQLCSSLDTISFDQSIRDGDFLVSKNETFVLGFFRPGTSSNRYVGIWYKFSEDKVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSSDHPTHALLSSMKLGLDKKSGINRFLTSWNSNNDPGTGNCSLRMDTNGSPQLILYKNLAKWWRSGQWNGIQWGGIPAEGSNNVFKINFVNNQDEIAVEWSVLDPSIYSVITIDGTGSLNQLSWQGQQHQWVTLWSAPLDACDSYGKCGQFGACNPYTNSGFNCTCYPGYEPNSPHDWDLRDGTGGCKRPQGSPSMCRNGEGFVKMENVKVPDTSTIKLNRSLSFEACGEECLRNCSCLAYASADVRNGGSGCMAWFGDLMDTKQFTEGGQDLYIRADALVLAQYTKKSGGGFSAKDRRLAIILGVSIAVTSLLIVAALCWFRRRSRKGRGGQPELLNDAIAGSRSHEDLLKKNEVDEHRGKTDLPFFDLSTIVAATDNFSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFMLGNETSLPPPKKAAFSFKNSGRDSSTSRGASSVNDVTVTVIEAR

Seg: seg
4-18 seg

LVLVRLLLLQLCSSL

ProfileScan: PS50927
IPR001480
18-144 BULB_LECTIN
Bulb-type lectin domain

LDTISFDQSIRDGDFLVSKNETFVLGFFRPGTSSNRYVGIWYKFSEDKVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSS

HMMSmart: SM00108
IPR001480
24-147 Bulb-type mannose-specific lectin
Bulb-type lectin domain

DQSIRDGDFLVSKNETFVLGFFRPGTSSNRYVGIWYKFSEDKVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSSDHP

superfamily: SSF51110
IPR001480
55-178 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

VGIWYKFSEDKVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSSDHPTHALLSSMKLGLDKKSGINRFLTSWNSNNDP

HMMPfam: PF01453
IPR001480
65-178 B_lectin
Bulb-type lectin domain

KVLWVANRDNPLNDTSGVLSINTDGNLILAHGNSSQGLPLWSTNVSVSSSGNNNIVAQLLDSGNFVLVQQDNQNVLWQSSDHPTHALLSSMKLGLDKKSGINRFLTSWNSNNDP

Seg: seg
108-118 seg

NVSVSSSGNNN

Gene3D: G3DSA:2.90.10.10
IPR001480
180-215 no description
Bulb-type lectin domain

TGNCSLRMDTNGSPQLILYKNLAKWWRSGQWNGIQW

HMMPfam: PF00954
IPR000858
205-315 S_locus_glycop
S-locus glycoprotein

WRSGQWNGIQWGGIPAEGSNNVFKINFVNNQDEIAVEWSVLDPSIYSVITIDGTGSLNQLSWQGQQHQWVTLWSAPLDACDSYGKCGQFGACNPYTNSGFNCTCYPGYEPN

ProfileScan: PS50026
IPR000742
280-318 EGF_3
Epidermal growth factor-like domain

PLDACDSYGKCGQFGACNPYTNSGFNCTCYPGYEPNSPH

ProfileScan: PS50948
IPR003609
339-420 PAN
Apple-like

CRNGEGFVKMENVKVPDTSTIKLNRSLSFEACGEECLRNCSCLAYASADVRNGGSGCMAWFGDLMDTKQFTEGGQDLYIRAD

HMMPfam: PF08276
IPR013227
339-405 PAN_2
PAN-2 domain

CRNGEGFVKMENVKVPDTSTIKLNRSLSFEACGEECLRNCSCLAYASADVRNGGSGCMAWFGDLMDT

HMMSmart: SM00473
IPR003609
340-419 divergent subfamily of APPLE domains
Apple-like

RNGEGFVKMENVKVPDTSTIKLNRSLSFEACGEECLRNCSCLAYASADVRNGGSGCMAWFGDLMDTKQFTEGGQDLYIRA

superfamily: SSF56112
IPR011009
492-792 Protein kinase-like (PK-like)
Protein kinase-like domain

LLKKNEVDEHRGKTDLPFFDLSTIVAATDNFSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFML

Gene3D: G3DSA:3.30.200.20
505-584 no description

TDLPFFDLSTIVAATDNFSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGC

HMMSmart: SM00220
IPR002290
522-791 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFM

HMMSmart: SM00219
IPR020635
522-792 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFML

ProfileScan: PS50011
IPR000719
522-798 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSANLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVVFMLGNETSL

HMMPfam: PF07714
IPR001245
526-789 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NLLGHGGFGMVFKGCLADGQEIAVKRLSRNSGQGVEEFKNEVMLIAKLQHRNLVRLLGCCIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFENSSLNLVGQMWDLWVEGKALDTVDPSLSRSYSTHEVMRCIQIGLLCVQEYATDRPTMLDVV

PatternScan: PS00107
IPR017441
528-550 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGGFGMVFKGCLADGQEIAVK

Gene3D: G3DSA:1.10.510.10
585-729 no description

CIDKEERMLIYEYMPNRSLDLCIFDKSRRSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNVLLDASMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVLALEIISGRKNNFHFEN

PatternScan: PS00108
IPR008271
643-655 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox