PRGDB00172521 (ppa018599m)

From PRG Wiki
Revision as of 03:25, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa018599m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCTAGAACTAGCTCTGCCTGTCTCAGTGTAGCTTCCTTCCTCTTTTTTTCAAGCTTACTGTGGAATTTCAATGCTGCAAGGGACACACTCAAACCAGGTGACACTCTAAATTCCTCAAGCTCCTTGGTTTCTGCAATGGGGAAATTCACCATGGGGTTCCATATTTATGACCACAATTTGAACTATAGCTACCTTGTTGTTAAGTGGGCTGCAAGTCATAATTATGCATGGATTGCCAATAGAAACAAACCCATTTTGTACCCTTTGGGAATTCTTACCTTGGACCAAAATAATACATTGAAAATTACACACAAGGATGGTGAGCCTGTTGTACTTTACTCTGCTTCAGAAACTAGCAATGCCAATAATATTGTGGCTACCCTTTTAGATTCTGGCAATTTTGGTTTTGTGGCAAAGCTTGTAGACGCCCTTCTGCCAGGTATGAAATTAGGTGTGAACCATAAAAGTGGTCATGTTTGGTCAATTTCATCATGGTTTACTCCTAACAGTGCAGTGCCAGGGGCTTTCACTCTTGATTGGGACCCGGAGGCACACGAATTGAAGATTAGACGGCGCGGGGTGGTTTATTGGAGCAGTGGAGCCTTTAGGAATGGGAGATTTAAATTTATTTTGCCTGATGAATCCAAGCTGAGGTATAATTTTAGTATTGTGTCAAATGAAGATGAAGATTACTTCACTTACAGTGCTGTAGATCAAAGTGGTATATCAGAATGGGTGCTAACCACAATGGGGAGACTATATGACTTTGATGAGACAATTGATATTGCACAAGCAGATTATTGTTATGGCTCCAACACTGATGGAGGGTGCCAGATGTGGGACCGGCCAATTGATTGTAGGCATGCTGGTGATAGATTTGAGGAAGAAAAGGGTTACTTCAATCCAACCGGCTCTGGTTCGACAGCAACGAGTGATGCTTCAAATACAAGCTTCAGCATCAGTGATTGTAAGGCTGCTTGCTGGAAAAATTGTGACTGCCTTGGATTCAACTATCTGTTTGATAATCAGACCGGATGTCGATTTTGGACTGGCCACTGGAAGTTCATCAAGGACAGCACAGGGGAGAACAGGAGAAAGATTGATGACAAGGAATTGCTGGACGTGAAGGAATCTTACTCATCTAACAATGTCAATGCGCTTCAGAATGATGGAGATATGGGGCATGATTTAAGAGTATTTAGCTATGCATCTGTCAAGGCAGCCACAGGAAACTTCTGTGACGAAAACAAGCTTGGAGAAGGGGGCTTTGGACCAGTTTATAAAGGGAAAATGTCGATGGGACAAGAAATAGCTGTGAAGAGGCTTTCAAGATGTTCACTACAAGGAACATGGGAGTTTAAGAATGAGTTGATACTTATATCTGAACTTCAACATACAAATCTTGTTCGGATTTTGGGATTTTGCATTCATGGTGTAGAGAGGATGTTAATATACGAGTATATGCCAAACAAAAGTCTGGACTGCTTTTTATTTGATTCAACAAGAGGCATGTTACTAGACTGGAAGAAGCGTTTTAATATAATCGAAGGAATTGCTCAAGGACTGCTTTACTTGCACAAATATTCAAGATTGAGGGTGATTCATAGAGATCTTAAAGCTAGTAACATACTACTTGATGAAGATATGAACCCCAAAATTTCTGACTTTGGTATGGCAAGGATTTTCACGCATAATGAGCGGGAAGCAAATACTAATAGGATCGTTGGGACATATGGTTACATGTCTCCTGAGTATGCAATGGGGGGAATTTTTTCAACAAAGTCCGATGTCTATAGCTTTGGTGTATTGACACTTGAAATCATAAGTGGTAGGAAAAATAATAGCTTCTACAATGCCGATCGCGTCTTGAATATAGTAGGATATGCATGGGGGTTATGGAATGAAGGTGCAGGGCTAAGATTAATGGATCCAACGCTACAGGAATCATTTATTGAGGATCAACTGATAAGATGCATCCATGTCGGTCTGCTATGCGTAGAAGAAGATGCAGCAGATCGGCCTACCATGTCAGAAGTCATATCTATGTTGACAAATGAAAGCATGTCATTACCTATACCAAAGAGGCCAGCATTTTTCACAAGCAGAAACGAGGTTGATGCAGACATGAGCGTAAAGGAATCAGAAGTTTTATCAGGAAATGACTTTTCCCGTTCCGATATAGTAGGAAGATGA


Protein sequences

Name Description Sequence
ppa018599m lectin protein kinase family protein (best arabidopsis hit)

MARTSSACLSVASFLFFSSLLWNFNAARDTLKPGDTLNSSSSLVSAMGKFTMGFHIYDHNLNYSYLVVKWAASHNYAWIANRNKPILYPLGILTLDQNNTLKITHKDGEPVVLYSASETSNANNIVATLLDSGNFGFVAKLVDALLPGMKLGVNHKSGHVWSISSWFTPNSAVPGAFTLDWDPEAHELKIRRRGVVYWSSGAFRNGRFKFILPDESKLRYNFSIVSNEDEDYFTYSAVDQSGISEWVLTTMGRLYDFDETIDIAQADYCYGSNTDGGCQMWDRPIDCRHAGDRFEEEKGYFNPTGSGSTATSDASNTSFSISDCKAACWKNCDCLGFNYLFDNQTGCRFWTGHWKFIKDSTGENRRKIDDKELLDVKESYSSNNVNALQNDGDMGHDLRVFSYASVKAATGNFCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISMLTNESMSLPIPKRPAFFTSRNEVDADMSVKESEVLSGNDFSRSDIVGR*

Domains

Domain Start-End Description Sequence

Seg: seg
5-21 seg

SSACLSVASFLFFSSLL

ProfileScan: PS50927
IPR001480
28-150 BULB_LECTIN
Bulb-type lectin domain

RDTLKPGDTLNSSSSLVSAMGKFTMGFHIYDHNLNYSYLVVKWAASHNYAWIANRNKPILYPLGILTLDQNNTLKITHKDGEPVVLYSASETSNANNIVATLLDSGNFGFVAKLVDALLPGMK

superfamily: SSF51110
IPR001480
61-172 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LNYSYLVVKWAASHNYAWIANRNKPILYPLGILTLDQNNTLKITHKDGEPVVLYSASETSNANNIVATLLDSGNFGFVAKLVDALLPGMKLGVNHKSGHVWSISSWFTPNSA

HMMPfam: PF01453
IPR001480
75-168 B_lectin
Bulb-type lectin domain

NYAWIANRNKPILYPLGILTLDQNNTLKITHKDGEPVVLYSASETSNANNIVATLLDSGNFGFVAKLVDALLPGMKLGVNHKSGHVWSISSWFT

Gene3D: G3DSA:2.90.10.10
IPR001480
75-140 no description
Bulb-type lectin domain

NYAWIANRNKPILYPLGILTLDQNNTLKITHKDGEPVVLYSASETSNANNIVATLLDSGNFGFVAK

ProfileScan: PS50948
IPR003609
287-373 PAN
Apple-like

CRHAGDRFEEEKGYFNPTGSGSTATSDASNTSFSISDCKAACWKNCDCLGFNYLFDNQTGCRFWTGHWKFIKDSTGENRRKIDDKEL

Seg: seg
304-320 seg

TGSGSTATSDASNTSFS

HMMPfam: PF08276
IPR013227
313-352 PAN_2
PAN-2 domain

DASNTSFSISDCKAACWKNCDCLGFNYLFDNQTGCRFWTG

superfamily: SSF56112
IPR011009
383-692 Protein kinase-like (PK-like)
Protein kinase-like domain

NNVNALQNDGDMGHDLRVFSYASVKAATGNFCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISMLTNESMSLP

Gene3D: G3DSA:3.30.200.20
396-489 no description

HDLRVFSYASVKAATGNFCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYM

HMMPanther: PTHR24420
397-716 FAMILY NOT NAMED,FAMILY NOT NAMED

DLRVFSYASVKAATGNFCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISMLTNESMSLPIPKRPAFFTSRNEVDADMSVKESE

HMMPanther: PTHR24420:SF430
397-716 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DLRVFSYASVKAATGNFCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISMLTNESMSLPIPKRPAFFTSRNEVDADMSVKESE

HMMSmart: SM00220
IPR002290
413-684 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISML

HMMSmart: SM00219
IPR020635
413-684 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISML

ProfileScan: PS50011
IPR000719
413-689 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FCDENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISMLTNESM

HMMPfam: PF07714
IPR001245
416-684 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

ENKLGEGGFGPVYKGKMSMGQEIAVKRLSRCSLQGTWEFKNELILISELQHTNLVRILGFCIHGVERMLIYEYMPNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISML

Gene3D: G3DSA:1.10.510.10
490-684 no description

PNKSLDCFLFDSTRGMLLDWKKRFNIIEGIAQGLLYLHKYSRLRVIHRDLKASNILLDEDMNPKISDFGMARIFTHNEREANTNRIVGTYGYMSPEYAMGGIFSTKSDVYSFGVLTLEIISGRKNNSFYNADRVLNIVGYAWGLWNEGAGLRLMDPTLQESFIEDQLIRCIHVGLLCVEEDAADRPTMSEVISML

PatternScan: PS00108
IPR008271
534-546 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox