PRGDB00172525 (ppa025426m)

From PRG Wiki
Revision as of 03:25, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa025426m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

S-locus lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCTTACGTTCATCAGAACACTCTAGCCTCATTTGATTCAAATGGAATCTTTGGAATAGGAATAGAGAAGGTATGGTATATCCACAAGGGTAACCTTCTAGGGCTACAAGAAGTAGTTGTAAAAATACTTTTGAGAAGGACTGACCAAGGCTTGGAGGAGTTTAAGAATGAGATTAGTCTGATTGCTAAATTACAACATAGGAATCTTTTCAGACTATTGGGCTACTGCATTCAAGAAAAAGAAAATATGTTTTATGAATATAAGCCAAACAAAATTTTCGATTTCTTTCTTTTCAATCCATCCAAGCAATCACTACTAGATTGGAGGAAACATTTCGATATTATTGAAGGGATTGCAAGAAGGGTCTTTTATGTCAATCAAGATTCTAGACTTAGAAAGATTCCTTGTGACCTAAAACGTAGCAACATTTTGCTAAATGGACATATGACTCCCCAAATTTCAGAACTTGGTATGGAAATAATATTCGGCATGAGTCAAAATGAAGCATATACAACCCGAGTTGTTGGCACATATAGTTATATGTCACCTGAATATGCAATGGAAGATCTATTTTCTGTAAAGGCAGTCTACAGCTTTGCGGTAGAGCTGCTTGAGATTGTGAGTGGCCGAAGGAACAATGGCTTACGCTCATCAGAACACTCTAGCTTCATTTGA


Protein sequences

Name Description Sequence
ppa025426m S-locus lectin protein kinase family protein (best arabidopsis hit)

MAYVHQNTLASFDSNGIFGIGIEKVWYIHKGNLLGLQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRRNNGLRSSEHSSFI*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
7-225 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NTLASFDSNGIFGIGIEKVWYIHKGNLLGLQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRRNNGLRSSEHSSFI

Gene3D: G3DSA:3.30.200.20
28-74 no description

IHKGNLLGLQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLL

HMMPanther: PTHR24420
28-225 FAMILY NOT NAMED,FAMILY NOT NAMED

IHKGNLLGLQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRRNNGLRSSEHSSFI

HMMPanther: PTHR24420:SF771
28-225 B120; PROTEIN KINASE/ SUGAR BINDING

IHKGNLLGLQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRRNNGLRSSEHSSFI

HMMSmart: SM00219
IPR020635
28-225 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IHKGNLLGLQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRRNNGLRSSEHSSFI

HMMPfam: PF07714
IPR001245
36-211 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LQEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGR

superfamily: SSF56112
IPR011009
37-212 Protein kinase-like (PK-like)
Protein kinase-like domain

QEVVVKILLRRTDQGLEEFKNEISLIAKLQHRNLFRLLGYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRR

Gene3D: G3DSA:1.10.510.10
75-212 no description

GYCIQEKENMFYEYKPNKIFDFFLFNPSKQSLLDWRKHFDIIEGIARRVFYVNQDSRLRKIPCDLKRSNILLNGHMTPQISELGMEIIFGMSQNEAYTTRVVGTYSYMSPEYAMEDLFSVKAVYSFAVELLEIVSGRR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox