PRGDB00172581 (ppa019627m)

From PRG Wiki
Revision as of 03:23, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa019627m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

CAAGATATACCACATGTTCCCATTCATGAAGTAATATTTTCAACCATTGACAAGCCTAAGCTTCTTAGCCAGCTTTCTGCTTTGCTTTCTGATTTAGGACTTAACATCCGTGAAGCACATGTTTTTTCAACGACCGATGGCTACTCCTTAGATGTTTTTGTGGTGGATGGATGGCCTCTTGAGGATACAGATGGTCTACATGAAGCTATGGAAAAGGCGGTTGCTAGAAGTGAGGGGTCATGGTCAAGATCTTCACATTCTCATTCGGCTGTGGAGAAAGCATTAGCGGCACAAGAAAAACCTGGAAACTGGGAAATAGACAGAAGACTATTAAAGATAGGAGACAGAATTGCATCTGGGTCATGTGGAGATTTGTACCGCGGAATTTATCTTGGTCAAGATGTTGCGGTTAAGATACTGAGGTCAGAGCATTTGAATGATGCTCTAGAGGATGAGTTTGCTCAAGAAGTGGAAATTCTGAGACAGGTCCATCATAGGAATGTTGTGCGCTTTATCGGGGCATGTACGAAGTCTCCACATTTGTGCATAGTGACAGAGTATATGCCCGGTGGAAGTCTCTATGATTATTTGCACAAGAATCATAATGTCTTGAAGCTTTCAGAACTGTTAAAGTTTGCAATTGATGTCTGCAAAGGAATGGAGTATTTGCATCATAATAACATAATTCATAGAGATCTGAAGACAGCAAATCTGCTAATGGACACTAACAACGTTGTAAAGGTGGCCGATTTTGGTGTTGCTCGGTTCCAAAATCAAGAGGGAGTAATGACAGCAGAGACTGGAACCTATCGATGGATGGCACCAGAGGTTATCAATCATCAACCATATGATCAGAAAGCAGATGTGTTCAGTTTTGCGATTGTACTTTGGGAGCTAGTAACAGCCAAAGTTCCATATGATACCATGACTCCGTTGCAAGCTGCCTTGGGAGTTAGACAGGGACTGAGACCGGATCTTCCCAGTACTGGACACCCAAAGCTGTTGGAATTAATGCAGAGATGTTGGGATGCAGATCCTTCCAATCGGCCTTCCTTCTCTGATATAATAGCGCAACTTGAATGTCTCCTCCAAGAAGTTCAGAGGCTATATTATTGTACAATCGAGGGAAAGAGAAAATCAGAGAGACTGCGAAACACAATGTCGATAGTGCATGAAGGTCTGTATTGCCTGTTGTAA


Protein sequences

Name Description Sequence
ppa019627m ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

QDIPHVPIHEVIFSTIDKPKLLSQLSALLSDLGLNIREAHVFSTTDGYSLDVFVVDGWPLEDTDGLHEAMEKAVARSEGSWSRSSHSHSAVEKALAAQEKPGNWEIDRRLLKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQLECLLQEVQRLYYCTIEGKRKSERLRNTMSIVHEGLYCLL*

Domains

Domain Start-End Description Sequence

superfamily: SSF55021
4-87 ACT-like

PHVPIHEVIFSTIDKPKLLSQLSALLSDLGLNIREAHVFSTTDGYSLDVFVVDGWPLEDTDGLHEAMEKAVARSEGSWSRSSHS

HMMPfam: PF01842
IPR002912
10-56 ACT
Amino acid-binding ACT

EVIFSTIDKPKLLSQLSALLSDLGLNIREAHVFSTTDGYSLDVFVVD

Gene3D: G3DSA:3.30.70.260
15-74 no description

TIDKPKLLSQLSALLSDLGLNIREAHVFSTTDGYSLDVFVVDGWPLEDTDGLHEAMEKAV

Seg: seg
21-34 seg

LLSQLSALLSDLGL

Seg: seg
74-92 seg

VARSEGSWSRSSHSHSAVE

superfamily: SSF56112
IPR011009
83-382 Protein kinase-like (PK-like)
Protein kinase-like domain

RSSHSHSAVEKALAAQEKPGNWEIDRRLLKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQLECLLQEVQRLYYCTIEGKRKSER

Gene3D: G3DSA:3.30.200.20
97-173 no description

AQEKPGNWEIDRRLLKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIG

HMMPanther: PTHR23257
104-388 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

WEIDRRLLKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQLECLLQEVQRLYYCTIEGKRKSERLRNTMS

HMMPanther: PTHR23257:SF82
104-388 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

WEIDRRLLKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQLECLLQEVQRLYYCTIEGKRKSERLRNTMS

HMMPfam: PF07714
IPR001245
111-359 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQL

HMMSmart: SM00219
IPR020635
111-359 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQL

HMMSmart: SM00220
IPR002290
111-362 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQLECL

ProfileScan: PS50011
IPR000719
111-363 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LKIGDRIASGSCGDLYRGIYLGQDVAVKILRSEHLNDALEDEFAQEVEILRQVHHRNVVRFIGACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQLECLL

Gene3D: G3DSA:1.10.510.10
174-359 no description

ACTKSPHLCIVTEYMPGGSLYDYLHKNHNVLKLSELLKFAIDVCKGMEYLHHNNIIHRDLKTANLLMDTNNVVKVADFGVARFQNQEGVMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELVTAKVPYDTMTPLQAALGVRQGLRPDLPSTGHPKLLELMQRCWDADPSNRPSFSDIIAQL

FPrintScan: PR00109
IPR001245
185-198 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

TEYMPGGSLYDYLH

FPrintScan: PR00109
IPR001245
222-240 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHHNNIIHRDLKTANLLM

PatternScan: PS00108
IPR008271
228-240 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTANLLM

FPrintScan: PR00109
IPR001245
268-278 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
287-309 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

ADVFSFAIVLWELVTAKVPYDTM

FPrintScan: PR00109
IPR001245
330-352 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

GHPKLLELMQRCWDADPSNRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox