PRGDB00172587 (ppa027155m)

From PRG Wiki
Revision as of 03:23, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa027155m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

DNA Sequence

ATGGCATTGAGCACCCAAAGAGACTCTGCCTTTCTTACTTCACCTGATCAGTCTGCTCCTCAACCGAACCATGATGTGTTTTTGAGTTTCAGGGGTGAGGACACTCGAAATAGCTTTGTATCCCATTTATACCACGAATTGCAGCTCAGGGGCATTAAAACATTCAAGGATGATCCAAAGCTTGAAAGAGGGACAGCTATCTCTTCGGGGCTCTTCAACGCAATCGACGAATCAAGGCTTGCAATCATTGTCCTCTCGCCAAATTACACGTCTTCTTCCTGGTGCTTGGATGAGCTTACAGAGATTCTCCAATGCATGAAATCCAAGAGCACCGTTCTGCCAGTGTTTTATCATGTGGATCCTTCCGACGTACGAAAACAAACCGGTAGTTTTGCGTGCGCATTCACTGAGCATGAAAAAAGGTTTAGGGAAGACATGGAAAAGGTGAAGAGCTGGAGAGCTGCTTTAACTGAAGTGGCCAATTTATCTGGGTTTGATTCAAAGAATGAGTGTGAAAGAAAGCTTATTGAAAAGATTGTTCAACGGGTGTGGAGTAAAACGCATCGCACATTCAAATTGTTGGATTCCACAGACTTTCTTGCTAATGTTAGAGAGGTTTCTCAACGTGGTAATCTTGTTGATCTACAAAGACAACTTCTTTCCCCAATCTTGAAGGATCAAATTACTCAAGTTTGGGATGAACAGTGGGGAATCTCTGTCATTAAGAATTGCTTGTGTAATAAAAAGGTTCTTCTCATTCTTGATGATGTGAGTGAATCAAGCCAACTTGAAAATTTGGCTGGTGAAAAGGATTGGTTTGGTAAGGGGAGTTTAATCATTATTACAACCAGAGATGAACGGTTGCTGTTAAAGCATGATGTGCAGGTATCATATAAGGTAGAGGGATTAGGTGATGATGATGCTCTTGAGCTCTTTAGTCGGAATGCCTTTAAAAAGAATGAGCCTGAGGAAGGTTATTTGGAATTGTCAAAAGGTTTTGTAAATTATGCCAGAGGACTTCCACTAGCTCTTAAACTTTTGGGATGCTTAGTGTATAAGAGAGATCAATATGAATGGAAAAGTGAATTGGATAAGCTGCAGAAAATTCCTAAGTCAGAAATTATTGATTTGCTCAAAATAAGTTACGATGGATTGGATGAGATGAATAAGGATATATTTCTTGATGTTGCATTTTTTCACAAGGGGATGTTCAAGGAGCGTGTAATTGAAATACTAGACTGCTGTGGCCTATGTGGTCATATTGGGATAAATGCTCTTGTTCAGAAATCACTTTTAACTATTGATATTTCAAATAACACGGTTGAGATGCATGATTTGATACAAGAAATGGCATTGGAAATTGTTCGTCGAGAGTGTCCTGAAGAGCCTGGTAGACGAAGTCGATTGTGCAATCATGATGATATCTCTCATGTATTCATAAACAATACGGCATATTCCAATTGTGAAGCCTTGTCTAAGATGCTTAACCTGAGATTTCTTGAATTTGATAATATGATGATTTCTTCAAGCCACGGAATTCTTCCTAATTCCTTGAGAAGTATCAAATGGAGTCGGTATCCTTCCAAATTTCTCCCATCAGATTTTCAACCGAATTTTCTTTTTGCACTTGAGATGCCTAATAGCAAACTTGTTGGGCTTTGGGATGGAAGAAAGGACTTGCCCAACTTGAAAAAAATGAACCTTTGTGGCTCTGAAAACTTGACCACAACCCCAGATTTCTCTGGCATTCCGAATCTTGAGGTGTTAGATTTTCTATTTTGTAAGAATTTGGTTGAGATTCACCCATCAATTGCAGATCTCAAATGTCTAACAACGTTGTCTCTTAGTTTTTGCTCAAAATCGAAAAAGACTCCAGAATTTTCAGGGCAAATGAAAAATGTGTCATGGCTTTGTTTATGTCAGACCTCCATTGAGAAATTATCTTCATCAATAGGATGTCTGGTTGGCCTTACTACTCTGCTTCTGTTGAATTGCAAAAATCTCGAGGGTTTTCCGAGTGAAATTTGTAATTTGAAGTCTCTTGAAGAATTGGATGCATCTAGATGCTCAAAAATTGACAAACTCCCAGAGAATGTGGGGGAGATGGAGTCTCTTACAAAGCTTCGATTTGATATTGGCTGCCTGTCCTCTTTAGCAGAATTCAAGCTTAGTGGAAACAATTTTGTTAGCCTTCCTGCAAGCATTGGATGTCTGTCTAAGCTTAAGTTATTTTGGGTGAATGGGTGCCAAAGGCTTCAACAATTGCCAGATCTTTCTAAGCTTATCTCATTAATGGATATAGACATAGCCGGTTGCACTTCCTTAAAAATGTTACCACATCTTTCGTCAAATTGCTCATTAGTGGATAACAAAATAGGTTATCGTAAGTTTAATTGTGCCAATTGCTTTGTATTGTTTGACAATGAAGGCTACGATAGTATAATACTGAAAATGCTACAGCGATATCTTCAGTGGTTTAGTAATCAAAGTTTGGGACATTCCCTAACTGTGGAGCTACCTACCACGTGGATGGGAATTGCTTTATGTGCTGTGTTTGAAGTTCAGGCTGATCTTTCTGATTTTCATTATTTTCAAATTAGCTGTTTCGCACAAGGATTGCTGCCACATGGAGTATTTTCAAAATATTTTAAAATAGGCGATGTTGTGTCAGATCACCTTTGGGTAATTTATGTATCTCGTAAAGAATTTGAGAAGATATGCGGTCAGATAAAGGTTTTGTTCACAACTTATTATTCTCAAGACATAATGTGGGGAGACAAAAAATCTTGTGTCAAGAAGTGTGGGTTTCGTTTGGTGCACGAGCAAGATGTGGAACAACTCAACCAGATCATGATGAACAAATCCATCATCAAGAGCACTACTACTTGTCCTACCAAATCAGCTGATGCACAAGGTCAACAACGCCACAATGACAAGGATGCTGGTCCTAGTGGAAGTGGTAGCTCTCACCAAAAATCTCTCTTCTGCAATACCTATGCTCTTTCCGAAGAGGCAGACCAAGATGAATTAAAATGA


Protein sequences

Name Description Sequence
ppa027155m disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

MALSTQRDSAFLTSPDQSAPQPNHDVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSGLFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEKRFREDMEKVKSWRAALTEVANLSGFDSKNECERKLIEKIVQRVWSKTHRTFKLLDSTDFLANVREVSQRGNLVDLQRQLLSPILKDQITQVWDEQWGISVIKNCLCNKKVLLILDDVSESSQLENLAGEKDWFGKGSLIIITTRDERLLLKHDVQVSYKVEGLGDDDALELFSRNAFKKNEPEEGYLELSKGFVNYARGLPLALKLLGCLVYKRDQYEWKSELDKLQKIPKSEIIDLLKISYDGLDEMNKDIFLDVAFFHKGMFKERVIEILDCCGLCGHIGINALVQKSLLTIDISNNTVEMHDLIQEMALEIVRRECPEEPGRRSRLCNHDDISHVFINNTAYSNCEALSKMLNLRFLEFDNMMISSSHGILPNSLRSIKWSRYPSKFLPSDFQPNFLFALEMPNSKLVGLWDGRKDLPNLKKMNLCGSENLTTTPDFSGIPNLEVLDFLFCKNLVEIHPSIADLKCLTTLSLSFCSKSKKTPEFSGQMKNVSWLCLCQTSIEKLSSSIGCLVGLTTLLLLNCKNLEGFPSEICNLKSLEELDASRCSKIDKLPENVGEMESLTKLRFDIGCLSSLAEFKLSGNNFVSLPASIGCLSKLKLFWVNGCQRLQQLPDLSKLISLMDIDIAGCTSLKMLPHLSSNCSLVDNKIGYRKFNCANCFVLFDNEGYDSIILKMLQRYLQWFSNQSLGHSLTVELPTTWMGIALCAVFEVQADLSDFHYFQISCFAQGLLPHGVFSKYFKIGDVVSDHLWVIYVSRKEFEKICGQIKVLFTTYYSQDIMWGDKKSCVKKCGFRLVHEQDVEQLNQIMMNKSIIKSTTTCPTKSADAQGQQRHNDKDAGPSGSGSSHQKSLFCNTYALSEEADQDELK*

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
12-165 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

LTSPDQSAPQPNHDVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSGLFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEKRFREDMEKVKSWRAALTEVANLSGF

ProfileScan: PS50104
IPR000157
22-162 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PNHDVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSGLFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEKRFREDMEKVKSWRAALTEVANL

Gene3D: G3DSA:3.40.50.10140
23-156 no description

NHDVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSGLFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEKRFREDMEKVKSWRAAL

HMMSmart: SM00255
IPR000157
23-162 Toll
Toll/interleukin-1 receptor homology (TIR) domain

NHDVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSGLFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEKRFREDMEKVKSWRAALTEVANL

HMMPfam: PF01582
IPR000157
26-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKLERGTAISSGLFNAIDESRLAIIVLSPNYTSSSWCLDELTEILQCMKSKSTVLPVFYHVDPSDVRKQTGSFACAFTEHEKRFREDMEKVKSWRAALT

HMMPanther: PTHR11017:SF20
204-868 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

REVSQRGNLVDLQRQLLSPILKDQITQVWDEQWGISVIKNCLCNKKVLLILDDVSESSQLENLAGEKDWFGKGSLIIITTRDERLLLKHDVQVSYKVEGLGDDDALELFSRNAFKKNEPEEGYLELSKGFVNYARGLPLALKLLGCLVYKRDQYEWKSELDKLQKIPKSEIIDLLKISYDGLDEMNKDIFLDVAFFHKGMFKERVIEILDCCGLCGHIGINALVQKSLLTIDISNNTVEMHDLIQEMALEIVRRECPEEPGRRSRLCNHDDISHVFINNTAYSNCEALSKMLNLRFLEFDNMMISSSHGILPNSLRSIKWSRYPSKFLPSDFQPNFLFALEMPNSKLVGLWDGRKDLPNLKKMNLCGSENLTTTPDFSGIPNLEVLDFLFCKNLVEIHPSIADLKCLTTLSLSFCSKSKKTPEFSGQMKNVSWLCLCQTSIEKLSSSIGCLVGLTTLLLLNCKNLEGFPSEICNLKSLEELDASRCSKIDKLPENVGEMESLTKLRFDIGCLSSLAEFKLSGNNFVSLPASIGCLSKLKLFWVNGCQRLQQLPDLSKLISLMDIDIAGCTSLKMLPHLSSNCSLVDNKIGYRKFNCANCFVLFDNEGYDSIILKMLQRYLQWFSNQSLGHSLTVELPTTWMGIALCAVFEVQADLSDFHYFQISC

HMMPanther: PTHR11017
204-868 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

REVSQRGNLVDLQRQLLSPILKDQITQVWDEQWGISVIKNCLCNKKVLLILDDVSESSQLENLAGEKDWFGKGSLIIITTRDERLLLKHDVQVSYKVEGLGDDDALELFSRNAFKKNEPEEGYLELSKGFVNYARGLPLALKLLGCLVYKRDQYEWKSELDKLQKIPKSEIIDLLKISYDGLDEMNKDIFLDVAFFHKGMFKERVIEILDCCGLCGHIGINALVQKSLLTIDISNNTVEMHDLIQEMALEIVRRECPEEPGRRSRLCNHDDISHVFINNTAYSNCEALSKMLNLRFLEFDNMMISSSHGILPNSLRSIKWSRYPSKFLPSDFQPNFLFALEMPNSKLVGLWDGRKDLPNLKKMNLCGSENLTTTPDFSGIPNLEVLDFLFCKNLVEIHPSIADLKCLTTLSLSFCSKSKKTPEFSGQMKNVSWLCLCQTSIEKLSSSIGCLVGLTTLLLLNCKNLEGFPSEICNLKSLEELDASRCSKIDKLPENVGEMESLTKLRFDIGCLSSLAEFKLSGNNFVSLPASIGCLSKLKLFWVNGCQRLQQLPDLSKLISLMDIDIAGCTSLKMLPHLSSNCSLVDNKIGYRKFNCANCFVLFDNEGYDSIILKMLQRYLQWFSNQSLGHSLTVELPTTWMGIALCAVFEVQADLSDFHYFQISC

HMMPfam: PF00931
IPR002182
205-417 NB-ARC,NBS
NB-ARC

EVSQRGNLVDLQRQLLSPILKDQITQVWDEQWGISVIKNCLCNKKVLLILDDVSESSQLENLAGEKDWFGKGSLIIITTRDERLLLKHDVQVSYKVEGLGDDDALELFSRNAFKKNEPEEGYLELSKGFVNYARGLPLALKLLGCLVYKRDQYEWKSELDKLQKIPKSEIIDLLKISYDGLDEMNKDIFLDVAFFHKGMFKERVIEILDCCGL

superfamily: SSF52540
206-374 P-loop containing nucleoside triphosphate hydrolases

VSQRGNLVDLQRQLLSPILKDQITQVWDEQWGISVIKNCLCNKKVLLILDDVSESSQLENLAGEKDWFGKGSLIIITTRDERLLLKHDVQVSYKVEGLGDDDALELFSRNAFKKNEPEEGYLELSKGFVNYARGLPLALKLLGCLVYKRDQYEWKSELDKLQKIPKSEI

FPrintScan: PR00364
IPR000767
244-258 DISEASERSIST
Disease resistance protein

CLCNKKVLLILDDVS

FPrintScan: PR00364
IPR000767
337-351 DISEASERSIST
Disease resistance protein

ARGLPLALKLLGCLV

Seg: seg
340-350 seg

LPLALKLLGCL

superfamily: SSF52058
454-799 L domain-like,LRR

IVRRECPEEPGRRSRLCNHDDISHVFINNTAYSNCEALSKMLNLRFLEFDNMMISSSHGILPNSLRSIKWSRYPSKFLPSDFQPNFLFALEMPNSKLVGLWDGRKDLPNLKKMNLCGSENLTTTPDFSGIPNLEVLDFLFCKNLVEIHPSIADLKCLTTLSLSFCSKSKKTPEFSGQMKNVSWLCLCQTSIEKLSSSIGCLVGLTTLLLLNCKNLEGFPSEICNLKSLEELDASRCSKIDKLPENVGEMESLTKLRFDIGCLSSLAEFKLSGNNFVSLPASIGCLSKLKLFWVNGCQRLQQLPDLSKLISLMDIDIAGCTSLKMLPHLSSNCSLVDNKIGYRKFNC

Gene3D: G3DSA:3.80.10.10
486-781 no description

SNCEALSKMLNLRFLEFDNMMISSSHGILPNSLRSIKWSRYPSKFLPSDFQPNFLFALEMPNSKLVGLWDGRKDLPNLKKMNLCGSENLTTTPDFSGIPNLEVLDFLFCKNLVEIHPSIADLKCLTTLSLSFCSKSKKTPEFSGQMKNVSWLCLCQTSIEKLSSSIGCLVGLTTLLLLNCKNLEGFPSEICNLKSLEELDASRCSKIDKLPENVGEMESLTKLRFDIGCLSSLAEFKLSGNNFVSLPASIGCLSKLKLFWVNGCQRLQQLPDLSKLISLMDIDIAGCTSLKMLPHL

Seg: seg
652-668 seg

GCLVGLTTLLLLNCKNL

FPrintScan: PR00364
IPR000767
676-692 DISEASERSIST
Disease resistance protein

CNLKSLEELDASRCSKI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox