PRGDB00172610 (ppa025472m)

From PRG Wiki
Revision as of 03:22, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa025472m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

DNA Sequence

ATGGCGTTGAGCACCCAAAGAGCCTCTGCTTTTCATCCTTCAGCTGATCAGTCGGCTCCTCCTCAATGGAACTACGATGTGTTTTTGAGTTTCAGGGGTGTAGACACTCGAAATAACTTTGTGTCCCATTTATTCCACGAATTGCAGCACAGGGGCATTAAAACATTCAAGGATGATCCAAAGCTTGAAAGAGGGACAACTATTTCTTCTGAGCTCTTCAAAGCAATCCAAGAATCAAGGCTTGCAATCGTTGTTCTCTCGCCAAACTATGCTTCTTCTTCCTGGTGCTTGGATGAACTTACAAAGATTCTCCAATGCATGAAATCCAACGGCACACTTCTGCCTGTGTTTTATAATGTGGATCCCTCCGATGTGCGAAAACAAAGCGGCAGTTTTGCTGACGCCTTCGCTGAGCATGAGAAAAGGTTTAGGGAAGACATCGATAAGGTGAAGCGCTGGAGAGATGCTTTAACAGAAGTTGCCAATTTAGCTGGGATAGATTCAAAAAATCAGTGTGAAAGAAAGCTCATTGAAAAGATTGTTGAATGGGTGTGGAGGAAAGTGCATCGCACATTCAAATTGTTAGATACAACAGAGTTAGTGGGAATTAAGTTTACACGAGAGCAAATGAATTTGCTTGTAGCTCCTACAGATGATGTTCGCTTTGTAGGGATATGGGGAATGGGCGGCATCGGCAAGACAACCATTGCTGCGCTAGTTCATGACAGCATTTGTATGCAGTTTGAAGTTAGTTGCTTTCTTGGTAATGTTAGAGAGGTTTCTCAACGTGGTAATCTTGTTGATCTACAAAGAAAGCTTCTTTCCCCGATCTTAAAGGAGCAAATAACTGATGTTAGGGATGAACAGTCGGGAACCTATTTCATTAAGAGTTGCTTATGTAATAAAAAGGTTCTTCTCATTCTTGATGATGTGAATGAATCAAGCCAACTAGAGAAATTTGCTAAGGAAAAGGATTGGTTTGGTAAGGGGAGTATCATCATCATTACAACTAGAGATGAACGGTTGGTTAAAAAGCATGATATGGAGATATCATATAAGGTAGAGGTATTAGGTGATGATGAGGCTCTTGAGCTCTTTAGTCTAAACGCCTTTAAAAAATTTGAGCCTGAGGAAGGTTTTTTGGAATTGTCCAAGTGCTTTGTAAATTATGCTGGAGGCCTTCCATTAGCTCTTAAAATTTTGGGATGCTCTATGTATAAGAGAGATCGAGATGAATGGAAAAACGAATTGGATAAGCTACGGAAAATTCCTGAGACTGAAATTTTTGATTTGCTCAAAATCAGTTTTGATAGATTAGATGAGATGAACAAGAATATATTTCTTGATGTTGCATTTTTTCATAAGGGGAAGGGCAAGAATGAAGTAATTGGAATACTAGACAGTTGTGACCGTTATGGTGGGATAAATGCTCTGGTTGAGAAGTCGCTCTTAACTATTGATATTTCATACAACGTTAACATTGTTGGGATGCATGATTTGATACAAGAAATGGCATTTGAAATTATTCGTCAAGAGTCTCCTGAAGAGCCCGGTGGACGTAGTCGATTGTGTCATCGTAATGACATCATTCATGTAATGATAAACAACACGGCAACTAACAAAATTCAAGGCATTGCCTTAAGCATGACAGAACTTGAAAAGGCGGATTGGAATTGTGAAGCATTCTCTAAGATGATTAACTTGAAATTTCTTGAAGTTGATAATGTGATCATTTCCCCAATGTCAATCCCCAAAATTCTTCCTAATTCCTTAAGAATTATGAAATGGAATCGGTATTCTTCCAAATTTCTCCCATCAAATTTTCAACCGACTAAACTTGTTTCACTTGAGATGCAGGACAGCAAACTAGTTGGGCTCTGGGATGACAAAATTGACTTGCCCAATTTGAAATACATGGACCTTAGTGGCTCTCAAAACTTGGAAACAACCCCAAATTTCACTGGCATTCCAAAACTTGAGGTGTTGAATCTTGAAAGGTGTGAGAATTTAGTTGAGATTCACCCATCCATTGCATTTCTCAAATGGCTTACAGATTTAATTCTAAATAGATGCAAAAGTGTTAAGGGTCTTCCAAGGGAGGTAGAAATGGATTCTCTTGTACATTTCGAGGTTGAAGATTGCTCAAAACTGAAAAAGATTCCAGAATTTTCAAGACAAATGGAAAAGTTGTCAATTCTTAATTTGAGGGGGACGCCCATTGAGAAATTACCTTCATCAATTGGACGTCTTGTTGGCCTTACTTTATTGGATGTAAGCAATTGTGAAAATCTCTGGGGTCTTTCGAGCGAAATTTGTAATTTGAAGTCTCTTCAAGAGCTCACGCGTAATAAATCAAGGTTTTGGTGGGGCCTCCAAAGAAAGGCTTTTGTGTTGGGTTCGCTATATGGATTATGGTCTTTGAAGTATTTGAATGTGAGTGATTGTGGTCTTTGTGAAGGGGATATTCCCGTCGATATTGACTGCTTATCCTCTTTAGAAATATTAGACCTTAGTCGAAACAATTTTGTTAGCCTTCCTGCAAGCATTGGATGTCTTACTAAGCTTTGGTCATTTTCGGTGAGAGGGTGCCAAAGGCTTCAACAATTGCCCCATTTCCGCTTTGGATTGGTTGATAATGAAGGCTTCAGCTCTATTTACATGCACACAGACGATTGCACTTCCTTAAAAACGTTGCCAAACTTGAGCATAAAAGGAGGAAGAGGTTTTGTTTCGTTGAGTTGTGTGAATTGCTCTGGATTGGTTGAGAATGATGGCTACGATGATAGTATAATACTTGGAATGCTCTGGACTGCTCTGGATTGGGGACTCCTTCAGGTACGCCCTTCGCCTATTCCAACGACTTCCGCTTTCCAAATTGTAACACCTGGAAGTAGAATTCCAGAGTGGTTCAATAATCAAACTGTAGGAGATTCCTTAATTGTGGAGCTACCTCCATGTACCACGTCCATTTGGATTGCTTTTTGTGCTGTCTTTGAAGAAGGTGCCCCTGTGGATCACCCAAATCCACCTCATGACCTTTCTACCTATTTTCGAATTGAATGTCGCCCAGGAGAAGGTCGCCCTGTGCATAGTTTTGGAATTAATAAAGGCCATCTTGTGTCACCTCACCTTTGGGTATCTTGTGTATATCATTTTGTAGTCGACAAAGAATGCAGTCAGATGAAGATTTCATTCCATAAGTTTTCTGAGGATGGCATAAACAGAATATATTGGTCGGGTATAAAGAAGTGTGGGTTCCGTTTGGTACACAAGCAAGACGGGAAAAAACTCAACCAAATCATGATGATGAACCACTCCATCAACATCAGCACAAAAGCTACTTCTCCTCACAATTCTCACAATTCAGTTGATGCAAGTGGAAGCTCTCACCAAAAATCTCTCTGCCGCAAAAGCTATGCTCTTTCCAAATGGTTTTTAACAAAACTTGTAAAGATTTTCTCCCTCTTTTTAACAACTGCAGTTTTTATCAAATCTTTCAACAATAGCGAACAATGGGGATGCATAGGACTTTTGATTTGGAGG


Protein sequences

Name Description Sequence
ppa025472m disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

MALSTQRASAFHPSADQSAPPQWNYDVFLSFRGVDTRNNFVSHLFHELQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALTEVANLAGIDSKNQCERKLIEKIVEWVWRKVHRTFKLLDTTELVGIKFTREQMNLLVAPTDDVRFVGIWGMGGIGKTTIAALVHDSICMQFEVSCFLGNVREVSQRGNLVDLQRKLLSPILKEQITDVRDEQSGTYFIKSCLCNKKVLLILDDVNESSQLEKFAKEKDWFGKGSIIIITTRDERLVKKHDMEISYKVEVLGDDEALELFSLNAFKKFEPEEGFLELSKCFVNYAGGLPLALKILGCSMYKRDRDEWKNELDKLRKIPETEIFDLLKISFDRLDEMNKNIFLDVAFFHKGKGKNEVIGILDSCDRYGGINALVEKSLLTIDISYNVNIVGMHDLIQEMAFEIIRQESPEEPGGRSRLCHRNDIIHVMINNTATNKIQGIALSMTELEKADWNCEAFSKMINLKFLEVDNVIISPMSIPKILPNSLRIMKWNRYSSKFLPSNFQPTKLVSLEMQDSKLVGLWDDKIDLPNLKYMDLSGSQNLETTPNFTGIPKLEVLNLERCENLVEIHPSIAFLKWLTDLILNRCKSVKGLPREVEMDSLVHFEVEDCSKLKKIPEFSRQMEKLSILNLRGTPIEKLPSSIGRLVGLTLLDVSNCENLWGLSSEICNLKSLQELTRNKSRFWWGLQRKAFVLGSLYGLWSLKYLNVSDCGLCEGDIPVDIDCLSSLEILDLSRNNFVSLPASIGCLTKLWSFSVRGCQRLQQLPHFRFGLVDNEGFSSIYMHTDDCTSLKTLPNLSIKGGRGFVSLSCVNCSGLVENDGYDDSIILGMLWTALDWGLLQVRPSPIPTTSAFQIVTPGSRIPEWFNNQTVGDSLIVELPPCTTSIWIAFCAVFEEGAPVDHPNPPHDLSTYFRIECRPGEGRPVHSFGINKGHLVSPHLWVSCVYHFVVDKECSQMKISFHKFSEDGINRIYWSGIKKCGFRLVHKQDGKKLNQIMMMNHSINISTKATSPHNSHNSVDASGSSHQKSLCRKSYALSKWFLTKLVKIFSLFLTTAVFIKSFNNSEQWGCIGLLIWR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
13-166 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

PSADQSAPPQWNYDVFLSFRGVDTRNNFVSHLFHELQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALTEVANLAGI

Gene3D: G3DSA:3.40.50.10140
22-157 no description

QWNYDVFLSFRGVDTRNNFVSHLFHELQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDAL

ProfileScan: PS50104
IPR000157
23-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WNYDVFLSFRGVDTRNNFVSHLFHELQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALTEVANL

HMMSmart: SM00255
IPR000157
24-163 Toll
Toll/interleukin-1 receptor homology (TIR) domain

NYDVFLSFRGVDTRNNFVSHLFHELQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALTEVANL

HMMPfam: PF01582
IPR000157
27-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGVDTRNNFVSHLFHELQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALT

HMMPanther: PTHR11017:SF20
48-980 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALTEVANLAGIDSKNQCERKLIEKIVEWVWRKVHRTFKLLDTTELVGIKFTREQMNLLVAPTDDVRFVGIWGMGGIGKTTIAALVHDSICMQFEVSCFLGNVREVSQRGNLVDLQRKLLSPILKEQITDVRDEQSGTYFIKSCLCNKKVLLILDDVNESSQLEKFAKEKDWFGKGSIIIITTRDERLVKKHDMEISYKVEVLGDDEALELFSLNAFKKFEPEEGFLELSKCFVNYAGGLPLALKILGCSMYKRDRDEWKNELDKLRKIPETEIFDLLKISFDRLDEMNKNIFLDVAFFHKGKGKNEVIGILDSCDRYGGINALVEKSLLTIDISYNVNIVGMHDLIQEMAFEIIRQESPEEPGGRSRLCHRNDIIHVMINNTATNKIQGIALSMTELEKADWNCEAFSKMINLKFLEVDNVIISPMSIPKILPNSLRIMKWNRYSSKFLPSNFQPTKLVSLEMQDSKLVGLWDDKIDLPNLKYMDLSGSQNLETTPNFTGIPKLEVLNLERCENLVEIHPSIAFLKWLTDLILNRCKSVKGLPREVEMDSLVHFEVEDCSKLKKIPEFSRQMEKLSILNLRGTPIEKLPSSIGRLVGLTLLDVSNCENLWGLSSEICNLKSLQELTRNKSRFWWGLQRKAFVLGSLYGLWSLKYLNVSDCGLCEGDIPVDIDCLSSLEILDLSRNNFVSLPASIGCLTKLWSFSVRGCQRLQQLPHFRFGLVDNEGFSSIYMHTDDCTSLKTLPNLSIKGGRGFVSLSCVNCSGLVENDGYDDSIILGMLWTALDWGLLQVRPSPIPTTSAFQIVTPGSRIPEWFNNQTVGDSLI

HMMPanther: PTHR11017
48-980 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LQHRGIKTFKDDPKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTKILQCMKSNGTLLPVFYNVDPSDVRKQSGSFADAFAEHEKRFREDIDKVKRWRDALTEVANLAGIDSKNQCERKLIEKIVEWVWRKVHRTFKLLDTTELVGIKFTREQMNLLVAPTDDVRFVGIWGMGGIGKTTIAALVHDSICMQFEVSCFLGNVREVSQRGNLVDLQRKLLSPILKEQITDVRDEQSGTYFIKSCLCNKKVLLILDDVNESSQLEKFAKEKDWFGKGSIIIITTRDERLVKKHDMEISYKVEVLGDDEALELFSLNAFKKFEPEEGFLELSKCFVNYAGGLPLALKILGCSMYKRDRDEWKNELDKLRKIPETEIFDLLKISFDRLDEMNKNIFLDVAFFHKGKGKNEVIGILDSCDRYGGINALVEKSLLTIDISYNVNIVGMHDLIQEMAFEIIRQESPEEPGGRSRLCHRNDIIHVMINNTATNKIQGIALSMTELEKADWNCEAFSKMINLKFLEVDNVIISPMSIPKILPNSLRIMKWNRYSSKFLPSNFQPTKLVSLEMQDSKLVGLWDDKIDLPNLKYMDLSGSQNLETTPNFTGIPKLEVLNLERCENLVEIHPSIAFLKWLTDLILNRCKSVKGLPREVEMDSLVHFEVEDCSKLKKIPEFSRQMEKLSILNLRGTPIEKLPSSIGRLVGLTLLDVSNCENLWGLSSEICNLKSLQELTRNKSRFWWGLQRKAFVLGSLYGLWSLKYLNVSDCGLCEGDIPVDIDCLSSLEILDLSRNNFVSLPASIGCLTKLWSFSVRGCQRLQQLPHFRFGLVDNEGFSSIYMHTDDCTSLKTLPNLSIKGGRGFVSLSCVNCSGLVENDGYDDSIILGMLWTALDWGLLQVRPSPIPTTSAFQIVTPGSRIPEWFNNQTVGDSLI

superfamily: SSF52540
183-428 P-loop containing nucleoside triphosphate hydrolases

WVWRKVHRTFKLLDTTELVGIKFTREQMNLLVAPTDDVRFVGIWGMGGIGKTTIAALVHDSICMQFEVSCFLGNVREVSQRGNLVDLQRKLLSPILKEQITDVRDEQSGTYFIKSCLCNKKVLLILDDVNESSQLEKFAKEKDWFGKGSIIIITTRDERLVKKHDMEISYKVEVLGDDEALELFSLNAFKKFEPEEGFLELSKCFVNYAGGLPLALKILGCSMYKRDRDEWKNELDKLRKIPETEI

HMMPfam: PF00931
IPR002182
211-458 NB-ARC,NBS
NB-ARC

NLLVAPTDDVRFVGIWGMGGIGKTTIAALVHDSICMQFEVSCFLGNVREVSQRGNLVDLQRKLLSPILKEQITDVRDEQSGTYFIKSCLCNKKVLLILDDVNESSQLEKFAKEKDWFGKGSIIIITTRDERLVKKHDMEISYKVEVLGDDEALELFSLNAFKKFEPEEGFLELSKCFVNYAGGLPLALKILGCSMYKRDRDEWKNELDKLRKIPETEIFDLLKISFDRLDEMNKNIFLDVAFFHKGKG

FPrintScan: PR00364
IPR000767
222-237 DISEASERSIST
Disease resistance protein

FVGIWGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
298-312 DISEASERSIST
Disease resistance protein

CLCNKKVLLILDDVN

FPrintScan: PR00364
IPR000767
391-405 DISEASERSIST
Disease resistance protein

AGGLPLALKILGCSM

Coil: coil
403-424 coiled-coil

CSMYKRDRDEWKNELDKLRKIP

superfamily: SSF52058
508-919 L domain-like,LRR

IIRQESPEEPGGRSRLCHRNDIIHVMINNTATNKIQGIALSMTELEKADWNCEAFSKMINLKFLEVDNVIISPMSIPKILPNSLRIMKWNRYSSKFLPSNFQPTKLVSLEMQDSKLVGLWDDKIDLPNLKYMDLSGSQNLETTPNFTGIPKLEVLNLERCENLVEIHPSIAFLKWLTDLILNRCKSVKGLPREVEMDSLVHFEVEDCSKLKKIPEFSRQMEKLSILNLRGTPIEKLPSSIGRLVGLTLLDVSNCENLWGLSSEICNLKSLQELTRNKSRFWWGLQRKAFVLGSLYGLWSLKYLNVSDCGLCEGDIPVDIDCLSSLEILDLSRNNFVSLPASIGCLTKLWSFSVRGCQRLQQLPHFRFGLVDNEGFSSIYMHTDDCTSLKTLPNLSIKGGRGFVSLSCVNCSG

Gene3D: G3DSA:3.80.10.10
578-871 no description

ISPMSIPKILPNSLRIMKWNRYSSKFLPSNFQPTKLVSLEMQDSKLVGLWDDKIDLPNLKYMDLSGSQNLETTPNFTGIPKLEVLNLERCENLVEIHPSIAFLKWLTDLILNRCKSVKGLPREVEMDSLVHFEVEDCSKLKKIPEFSRQMEKLSILNLRGTPIEKLPSSIGRLVGLTLLDVSNCENLWGLSSEICNLKSLQELTRNKSRFWWGLQRKAFVLGSLYGLWSLKYLNVSDCGLCEGDIPVDIDCLSSLEILDLSRNNFVSLPASIGCLTKLWSFSVRGCQRLQQLPH

FPrintScan: PR00364
IPR000767
631-647 DISEASERSIST
Disease resistance protein

IDLPNLKYMDLSGSQNL

ProfileScan: PS51450
IPR001611
658-681 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLNLERCENLVEIHPSIAFLK

HMMPfam: PF00560
IPR001611
658-678 LRR_1
Leucine-rich repeat

KLEVLNLERCENLVEIHPSIA

HMMSmart: SM00369
IPR003591
727-750 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MEKLSILNLRGTPIEKLPSSIGRL

ProfileScan: PS51450
IPR001611
729-750 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLSILNLRGTPIEKLPSSIGRL

HMMSmart: SM00369
IPR003591
829-852 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEILDLSRNNFVSLPASIGCL

HMMPfam: PF00560
IPR001611
831-852 LRR_1
Leucine-rich repeat

SLEILDLSRNNFVSLPASIGCL

ProfileScan: PS51450
IPR001611
831-852 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILDLSRNNFVSLPASIGCL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox