PRGDB00172626 (ppa015709m)

From PRG Wiki
Revision as of 03:22, 6 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
ppa015709m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

receptor lectin kinase (best arabidopsis hit)

DNA Sequence

ATGTTTTTCAAGCTTGTTATAGTCATACTAGTAAGCCTAGCAGCAGCTGAAGATCTCAATTTCACCTACAATGGTTTCCTGTCTGCTAATCTTAGCCTAGATGGCGTAGCCCACATCACATCCAATGGCCTTCTGAAGCTTACAAATGACACTGGACTCGGCCATGCCTTCTACCCCAACCCAGTAACCTTCAAGAACTCATCCAATGCTACCGCTTTCTCCTTCTCTACCACTTTTGTGTTCGCTATCAGATCCAGATTGGGACCGCGTTTGGGTGGCCATGGAATTGCCTTTGTCATTGCTCCGACAAGAGGGCTCCCGGGAGGTTTTAAAAACCAGTACCTGGGCGTTTTCAATGAAACCAACAACGGCAACGCCAACAACCATATTTTTGCTGTAGAGCTTGACTCCTTTCAGGACCCCGAGCTTGGCGACATCAACAACAACCATGTTGGGATTGATATCAATGGTTTGCGCTCAGTGAAATCAACTCCAGCGGGATATCATGCTCTAAACAATGGCGGTTTCCGAAACTTGACCCTCATCAGTGGTCAACCAATGCAAGTTTGGGTGGATTATGATGGTATCCAGAAGCAAATCAATGTCACTTTGGGTCCAATCAATGTTGATAAACCCCATATTCCACTCTTGTCTTTGAAGAATGACCTTTCCACGGTCCTTAACACGACCATGTATGTTGGCTTCTCCTCTACCCCTGGCTCAGTCATCACATCTCATTATGTTCTAGGATGGAGCTTTGAGATGAATGGCCAGGCTCCAGAACTTGTTCTCTCACAACTTCCTAAGCTGCCCCGAATAGGACGTAAAAAAATATCTAATATTTTGACCGTTGGTGTGCCTGTGATGTCTGTGAGTTTGGTTTTGCTAGCAATTTCAAGTTTAATTTATGCCATAAGAAGGAAGAAGAAGTTTGCAGAGCTGCTTGAAGATTGGGAGCTTGAGTATGGGCCTCAAAGGTTTAAATACAAAGAGTTATATATGGCAACAAAAGGGTTTAGGGAGAAGGAGCTTTTGGGAACTGGGGGATTTGGTAAGGTCTATAAAGGCATATTACCTTCCTCCAAAACTGAGATTGCAGTGAAGAGGGTCTCACATGAATCAAGACAGGGGATGAGGGAGTTTGTTGCAGAAGTTATTAGCATTGGCAGACTTCGTCACCGAAATTTAGTACCACTGTTGGGATATTGCAGAAGAAAAGGGGAGCTGCTCTTGGTCTATGACTACATGCCTAATGGAAGCCTGGACAAATACCTATACGACCAACCAGTGGTCACTCTCAATTGGAGGCAGAGGTTCAGAGTGATCAAAGGTGTGGCTTCAGGGTTGTTCTATCTTCATGAAGAATGGGAACAAGTTGTGGTTCACAGAGATGTGAAGGCCAGTAACATATTACTAGATTCAAAATTTAATGCAAGACTAGGAGATTTTGGCCTTGCAAGATTATATGACCACGGAAAGGACCCTAAGACTACTCGTATAGTTGGAACACTTGGGTATCTAGCTCCGGAGAATGCAAGATTAGGCAGGGCCACAACGCACGCCGATGTGTTTTCTTTTGGGGCATTTTTGCTTGAAGTTGCCTGTGGAAGAAGGCCAATACAGACACAAGGTGTTCTGGTTGATTTGGTGTTTTTTTGTTGGAAGAGAAGTAATATTCTTGAGGTAATAGATATAAATTTGGGTTCAGAATTCGTAGCTGAGGAGGTGGAATTGGTGCTGAAGCTTGGGCTGTTGTGCTCTCATTCAGAGCCTTCTGCTAGGCCAAGCATGCGTCAAGTAGTGCATTATTTAGAGGGTGACATTCCACTGCCGGAGTTATCATCTCTTGGTCTTTCTTCTGGTGGCTTGAAGTTCGCACACCACGAAAATTTTGATGATTCGGCAATGTCATATCCGTCTTCTATGGGCAAGGAGATGTCATATGTGCCAGAGTCATCACTTCTCTCAGGGGGTCGCTGA


Protein sequences

Name Description Sequence
ppa015709m receptor lectin kinase (best arabidopsis hit)

MFFKLVIVILVSLAAAEDLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGLGHAFYPNPVTFKNSSNATAFSFSTTFVFAIRSRLGPRLGGHGIAFVIAPTRGLPGGFKNQYLGVFNETNNGNANNHIFAVELDSFQDPELGDINNNHVGIDINGLRSVKSTPAGYHALNNGGFRNLTLISGQPMQVWVDYDGIQKQINVTLGPINVDKPHIPLLSLKNDLSTVLNTTMYVGFSSTPGSVITSHYVLGWSFEMNGQAPELVLSQLPKLPRIGRKKISNILTVGVPVMSVSLVLLAISSLIYAIRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYLEGDIPLPELSSLGLSSGGLKFAHHENFDDSAMSYPSSMGKEMSYVPESSLLSGGR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF435
1-615 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MFFKLVIVILVSLAAAEDLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGLGHAFYPNPVTFKNSSNATAFSFSTTFVFAIRSRLGPRLGGHGIAFVIAPTRGLPGGFKNQYLGVFNETNNGNANNHIFAVELDSFQDPELGDINNNHVGIDINGLRSVKSTPAGYHALNNGGFRNLTLISGQPMQVWVDYDGIQKQINVTLGPINVDKPHIPLLSLKNDLSTVLNTTMYVGFSSTPGSVITSHYVLGWSFEMNGQAPELVLSQLPKLPRIGRKKISNILTVGVPVMSVSLVLLAISSLIYAIRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYLEGDIPLPELSS

HMMPanther: PTHR24420
1-615 FAMILY NOT NAMED,FAMILY NOT NAMED

MFFKLVIVILVSLAAAEDLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGLGHAFYPNPVTFKNSSNATAFSFSTTFVFAIRSRLGPRLGGHGIAFVIAPTRGLPGGFKNQYLGVFNETNNGNANNHIFAVELDSFQDPELGDINNNHVGIDINGLRSVKSTPAGYHALNNGGFRNLTLISGQPMQVWVDYDGIQKQINVTLGPINVDKPHIPLLSLKNDLSTVLNTTMYVGFSSTPGSVITSHYVLGWSFEMNGQAPELVLSQLPKLPRIGRKKISNILTVGVPVMSVSLVLLAISSLIYAIRRKKKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYLEGDIPLPELSS

superfamily: SSF49899
IPR008985
16-276 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

AEDLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGLGHAFYPNPVTFKNSSNATAFSFSTTFVFAIRSRLGPRLGGHGIAFVIAPTRGLPGGFKNQYLGVFNETNNGNANNHIFAVELDSFQDPELGDINNNHVGIDINGLRSVKSTPAGYHALNNGGFRNLTLISGQPMQVWVDYDGIQKQINVTLGPINVDKPHIPLLSLKNDLSTVLNTTMYVGFSSTPGSVITSHYVLGWSFEMNGQAPELVLSQLPKLPRIGRK

Gene3D: G3DSA:2.60.120.200
IPR013320
17-272 no description
Concanavalin A-like lectin/glucanase, subgroup

EDLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGLGHAFYPNPVTFKNSSNATAFSFSTTFVFAIRSRLGPRLGGHGIAFVIAPTRGLPGGFKNQYLGVFNETNNGNANNHIFAVELDSFQDPELGDINNNHVGIDINGLRSVKSTPAGYHALNNGGFRNLTLISGQPMQVWVDYDGIQKQINVTLGPINVDKPHIPLLSLKNDLSTVLNTTMYVGFSSTPGSVITSHYVLGWSFEMNGQAPELVLSQLPKLPR

HMMPfam: PF00139
IPR001220
18-254 Lectin_legB
Legume lectin domain

DLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGLGHAFYPNPVTFKNSSNATAFSFSTTFVFAIRSRLGPRLGGHGIAFVIAPTRGLPGGFKNQYLGVFNETNNGNANNHIFAVELDSFQDPELGDINNNHVGIDINGLRSVKSTPAGYHALNNGGFRNLTLISGQPMQVWVDYDGIQKQINVTLGPINVDKPHIPLLSLKNDLSTVLNTTMYVGFSSTPGSVITSHYVLGWSFE

Seg: seg
66-82 seg

NSSNATAFSFSTTFVFA

Seg: seg
290-302 seg

SVSLVLLAISSLI

superfamily: SSF56112
IPR011009
309-612 Protein kinase-like (PK-like)
Protein kinase-like domain

KKFAELLEDWELEYGPQRFKYKELYMATKGFREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYLEGDIPLPE

Gene3D: G3DSA:3.30.200.20
319-403 no description

ELEYGPQRFKYKELYMATKGFREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYC

HMMSmart: SM00219
IPR020635
339-604 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYL

HMMSmart: SM00220
IPR002290
339-604 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYL

ProfileScan: PS50011
IPR000719
339-613 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FREKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVHYLEGDIPLPEL

HMMPfam: PF00069
IPR000719
340-602 Pkinase,Ser-thr
Protein kinase, catalytic domain

REKELLGTGGFGKVYKGILPSSKTEIAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVVH

PatternScan: PS00107
IPR017441
345-368 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGTGGFGKVYKGILPSSKTEIAVK

Gene3D: G3DSA:1.10.510.10
404-601 no description

RRKGELLLVYDYMPNGSLDKYLYDQPVVTLNWRQRFRVIKGVASGLFYLHEEWEQVVVHRDVKASNILLDSKFNARLGDFGLARLYDHGKDPKTTRIVGTLGYLAPENARLGRATTHADVFSFGAFLLEVACGRRPIQTQGVLVDLVFFCWKRSNILEVIDINLGSEFVAEEVELVLKLGLLCSHSEPSARPSMRQVV

PatternScan: PS00108
IPR008271
460-472 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDVKASNILL

Seg: seg
572-585 seg

VAEEVELVLKLGLL

Seg: seg
613-623 seg

LSSLGLSSGGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox