PRGDB00181460 (Si025828m)

From PRG Wiki
Revision as of 22:40, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Si025828m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

LRR and NB-ARC domains-containing disease resistance protein (best arabidopsis hit); powdery mildew resistance protein PM3b, putative, expressed (best rice hit)

DNA Sequence

ATGGCTGGACTAGCGGTCAGCCTGGTGGTGGGCCCACTGGTGTCCCTGGTGAAGGAGAAGGCGTCCAACTATCTCCTGGACAAGTACAAGGTGATGGAGGGTATGGAGAAGCAGCACGAGGTCCTCAAGCGCAAGCTGCCTGCCATCCTCGACGTCATCGCCGACGCTGAGAAGCAGGCGTCCCACCAGAAAGGAGTGAAGGTATGGCTTGGCAGGCTCAAGACGGTGGCATACCAGGCGATCGACATCTTTGATGAGTTCGAGTATGAGGCGCTCCGTCGTCAAGCCAAGAAGAATGGGCACATCACCAAGCTTGGCAAGGCTGGAGTAAAGCTCTTTCCTACCCACAACCGTGTTATATTCCGTATCAGGATGGCCAGCAAGCTTCAACGCGTTGTTGGCGCCATCAAGGTCCTTGTGGATCAAATGAACGACTTTGGGTTCAACAGGCTTCAACACCAGCAGGCACCAGCACTGAAGGAGGGGCGTGAGACGGATTCCAATATCGTTGATCCTAAAAATATTGTTAGCCGATCTAGGCACGAGGAAAGGAAGAAAATTGTTGAGATATTGGTCAACGATCAAGCTACCAATGGTGATCTCAAGGTTCTTCCCATCGTTGGAATGGGAGGTTTGGGCAAGACTACCCTCGCTCAGCTCATCTACAACGATCCTCAAGTCAAGGATCATTTTCAGCTACTAAAGTGGGTGTGTGTGTCAGATGATTTCAATCTATGTAATCTTGCCAACAAAATTTGCAACGCTTCGGAGGGTTCCCTTGAAAAGGCACTGAAGGAGCTTCAGGAACAGCTTAAGGGAAAGAGGTACCTTCTTGTATTGGATGACGTATGGGATGAGGAGAGCTTCTTGGACAAGTGGGAAAAGTTCAAGGCCTGTCTTGAACAAGGTGGTGTCGGTAGTGCCGTACTAACAACCACCCGTAACACAGAAATAGCTCAATTAATGGGTACAGTTGGGATCTCACACGAAAGGAAATACCTTGATGTCGGAAATTTAGGCAAGGAATTCATACAGGAAATTATTGAAACAAGAGCATTCAGTTTGCATAAGCGAGATGATGAGCTTGTAAACCTGGTTGGTCCGATTGCAGAGAGATGTGCTGGGTCGCCATTGGCAGCCAAAGCTCTGGGGTCTATATTGCGTAAGAAGACCACTACGGAAGAATGGGAGGATGTGCTACAGAGAAGCAACATATGCACTGTTGAGACTGGAATTTTGCCTATACTTAAGCTTAGCTACGATGAGTTGCCAACTGACATGAAGCCATGCTTTGCTTTTTGTGCTCTGTATCCAAAGGATTATCAAATTGATGTGGACAACCTTATCCAACTATGGATGGCTAATGGTTTTATCGTCTTCGAACAAAACAAGGTACCAATTGAAACCGTGGGTAAACGGATTGTCAACGAGATGGTTTCAAGGTCATTGTTCGAGCATGTGGAGCAAGATCCAACAAAGTTCGGGTATAGTTCTACAACTTTTTTGAAGATCCATGACCTTATGCACGATGTTGCAGTGTCTGCTACAGAAGACGAGTACATATATGTAACTGATGAAATGGATGAAAGTGGTAAATTACTTCCAAGTGCTACCCGCCATATACATTTTGAAACATGGGAGGGACAACTTTTTGCAAATATTGATATTTTATCTATCCGAACGTTGCTTGTAGTTCCTGGGAGATATTATCGAGATGAGCTGCATTCATCCAAATATAGTTCTCTGCGAGCACTTGCTCTACCAGCATCATATTATAAATATTTGCCAATGAAACCAAAGAATCTGCACCACCTTAGGTACCTTGATATCTCTAAGAGTACAATCAAAGCACTTCCAGATGACATAAGCATACTATATAATCTTCAGACACTTAAACTTTCTGGTTGTGAGGAACTTAGTATGCTTCCGAAGCAAATGAAGTACATGACTGCCCTTTGTCATCTCTACACTGATGGATGCACCAAGTTACAGTGTATGCCTCCGGAGCTTGGACGACTCACCTCTCTTCGAACACTTACATGTTTTGTAGTGAGCAGTGACTCGGATTGTAGTAGTCTTGGAGAGCTAAAAAATTTGAACATTGGTGGTTCACTAGAGCTAAAGCAGCTCGAAAATGTGACAGAAGCAAGAAATGCAAGACAAGCAAATCTTGGAAATAAGAAGGAACTGAGACAGCTGTCATTAAGGTGGACAAGTGGTAAGGGGGAGGAACAGCAATGTAACGAGGTGCTAGAGGTTCTCGAAGTTCATGATAGACTACTAGCTCTAGAAATAGAAGCCTACCAAGGCACCAATTTTCCATTATGGATGGGTGCGTTAAGAAACATGGTTGAGCTTCGGCTATCTGATTGTAGCAAATCTGAGCAGCTTCCTCCATTGTGCCAGTTACCAGCACTACAGCTTCTTCATTTGGAAGGATTGACACAGTTGCAGTTCTTGTGCAGCAGTTGTACATCCTCCACATTTGGAAAGCTTAAGGATCTTAAGCTTGATTATCTTCCTAATTTTGATAGGTTTTATGATCAGGTAGTGCAAGAAGAGCTAGTAGCATTTCCTCAGCTCGAGAAATTGCATATTGAAGGCTGCAGAGAATTGACAGCATTACCAGAAGCGGGAGTGCTCAGAAAATGGTATGATGGTGGAGAATATACAATGGTCCGCTCAGCATTCCCAGAATTGAAGAGCCTCGTATTGATAGATTTATGGAGCTTTGAGAGATGGGAGGCTGCCATTGAAATTGAAGTAGAACATGCACTATTCCCTTTGCTTGAGACTGTCCGTATTTATCGTTGCGACAAGTTAACCACTCTGCCTAGAGCACCAAAGCTCAGGGAACTATGCCTATCTATGAATTATTATAAAAACCAACAGAGGTCCCTGGGAGCAACTAGATATATGACGTCACTGTCCAATTTGAAACTGGAAAGAGTCGAGGTGGATGGCAAGGACAAATGGGACTATATTTCATCTGTGACAAATATGCACCTTGACTCCTGCAGTTTGTTCTTCCAATCACATGCACTAGCTCTGTGGGCTTGTTTTCGGCAGCTGCAAGATCTGGTTATCAGGAGGGCGAATGACCTAATCTACTGGCCGGAAAACGAGTTCCAAAATTTGGTTTCCTTGCGGAGGCTGTATATTGGGGATTGCGAGAGTCTGGTTGGATATGCTCCTGACCAGGCAACATTAGAAAGGAGCCAACTTTTGCCCTGCCTCGAGTCTCTAAGTATATCTTTTTGCGATAGTCTGGTAGAGGTCTTCAACCCTACCCCTGCCCTCAAGGAGATGGATGTTGAATACTGTAAAAATCTGAAGACCATATCCTTCAAGCAACAGGACAAGACATCATTAAATGCAGGTCATCCTAGCACTGACGTCATCATGGCATCCACTGCTGTACAGGATCTCTCACCATCCGCCGGCCGGAGTAATTTCCTTCCATCATCTCTAGAAACTCTGACAATCGATGAATGTGATGGATTGTTAGAGGTTCTCAATCTTCCCTCATCCCTTAAAGAAATATATATTAGTGGTTGCTCCCAACTACAAATCCTATCAGGCGAGCTGGATGCACTCAGTTACCTATCAGACGACTGTCCAGCTATAAAGGACCTGCGGGAGCGGTATGGCATCCATTTCTGA


Protein sequences

Name Description Sequence
Si025828m LRR and NB-ARC domains-containing disease resistance protein (best arabidopsis hit); powdery mildew resistance protein PM3b, putative, expressed (best rice hit)

MAGLAVSLVVGPLVSLVKEKASNYLLDKYKVMEGMEKQHEVLKRKLPAILDVIADAEKQASHQKGVKVWLGRLKTVAYQAIDIFDEFEYEALRRQAKKNGHITKLGKAGVKLFPTHNRVIFRIRMASKLQRVVGAIKVLVDQMNDFGFNRLQHQQAPALKEGRETDSNIVDPKNIVSRSRHEERKKIVEILVNDQATNGDLKVLPIVGMGGLGKTTLAQLIYNDPQVKDHFQLLKWVCVSDDFNLCNLANKICNASEGSLEKALKELQEQLKGKRYLLVLDDVWDEESFLDKWEKFKACLEQGGVGSAVLTTTRNTEIAQLMGTVGISHERKYLDVGNLGKEFIQEIIETRAFSLHKRDDELVNLVGPIAERCAGSPLAAKALGSILRKKTTTEEWEDVLQRSNICTVETGILPILKLSYDELPTDMKPCFAFCALYPKDYQIDVDNLIQLWMANGFIVFEQNKVPIETVGKRIVNEMVSRSLFEHVEQDPTKFGYSSTTFLKIHDLMHDVAVSATEDEYIYVTDEMDESGKLLPSATRHIHFETWEGQLFANIDILSIRTLLVVPGRYYRDELHSSKYSSLRALALPASYYKYLPMKPKNLHHLRYLDISKSTIKALPDDISILYNLQTLKLSGCEELSMLPKQMKYMTALCHLYTDGCTKLQCMPPELGRLTSLRTLTCFVVSSDSDCSSLGELKNLNIGGSLELKQLENVTEARNARQANLGNKKELRQLSLRWTSGKGEEQQCNEVLEVLEVHDRLLALEIEAYQGTNFPLWMGALRNMVELRLSDCSKSEQLPPLCQLPALQLLHLEGLTQLQFLCSSCTSSTFGKLKDLKLDYLPNFDRFYDQVVQEELVAFPQLEKLHIEGCRELTALPEAGVLRKWYDGGEYTMVRSAFPELKSLVLIDLWSFERWEAAIEIEVEHALFPLLETVRIYRCDKLTTLPRAPKLRELCLSMNYYKNQQRSLGATRYMTSLSNLKLERVEVDGKDKWDYISSVTNMHLDSCSLFFQSHALALWACFRQLQDLVIRRANDLIYWPENEFQNLVSLRRLYIGDCESLVGYAPDQATLERSQLLPCLESLSISFCDSLVEVFNPTPALKEMDVEYCKNLKTISFKQQDKTSLNAGHPSTDVIMASTAVQDLSPSAGRSNFLPSSLETLTIDECDGLLEVLNLPSSLKEIYISGCSQLQILSGELDALSYLSDDCPAIKDLRERYGIHF*

Domains

Domain Start-End Description Sequence

Seg: seg
2-17 seg

AGLAVSLVVGPLVSLV

HMMPanther: PTHR23155
6-1152 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSLVVGPLVSLVKEKASNYLLDKYKVMEGMEKQHEVLKRKLPAILDVIADAEKQASHQKGVKVWLGRLKTVAYQAIDIFDEFEYEALRRQAKKNGHITKLGKAGVKLFPTHNRVIFRIRMASKLQRVVGAIKVLVDQMNDFGFNRLQHQQAPALKEGRETDSNIVDPKNIVSRSRHEERKKIVEILVNDQATNGDLKVLPIVGMGGLGKTTLAQLIYNDPQVKDHFQLLKWVCVSDDFNLCNLANKICNASEGSLEKALKELQEQLKGKRYLLVLDDVWDEESFLDKWEKFKACLEQGGVGSAVLTTTRNTEIAQLMGTVGISHERKYLDVGNLGKEFIQEIIETRAFSLHKRDDELVNLVGPIAERCAGSPLAAKALGSILRKKTTTEEWEDVLQRSNICTVETGILPILKLSYDELPTDMKPCFAFCALYPKDYQIDVDNLIQLWMANGFIVFEQNKVPIETVGKRIVNEMVSRSLFEHVEQDPTKFGYSSTTFLKIHDLMHDVAVSATEDEYIYVTDEMDESGKLLPSATRHIHFETWEGQLFANIDILSIRTLLVVPGRYYRDELHSSKYSSLRALALPASYYKYLPMKPKNLHHLRYLDISKSTIKALPDDISILYNLQTLKLSGCEELSMLPKQMKYMTALCHLYTDGCTKLQCMPPELGRLTSLRTLTCFVVSSDSDCSSLGELKNLNIGGSLELKQLENVTEARNARQANLGNKKELRQLSLRWTSGKGEEQQCNEVLEVLEVHDRLLALEIEAYQGTNFPLWMGALRNMVELRLSDCSKSEQLPPLCQLPALQLLHLEGLTQLQFLCSSCTSSTFGKLKDLKLDYLPNFDRFYDQVVQEELVAFPQLEKLHIEGCRELTALPEAGVLRKWYDGGEYTMVRSAFPELKSLVLIDLWSFERWEAAIEIEVEHALFPLLETVRIYRCDKLTTLPRAPKLRELCLSMNYYKNQQRSLGATRYMTSLSNLKLERVEVDGKDKWDYISSVTNMHLDSCSLFFQSHALALWACFRQLQDLVIRRANDLIYWPENEFQNLVSLRRLYIGDCESLVGYAPDQATLERSQLLPCLESLSISFCDSLVEVFNPTPALKEMDVEYCKNLKTISFKQQDKTSLNAGHPSTDVIMASTAVQDLSPSAGRSNF

HMMPanther: PTHR23155:SF124
6-1152 OS01G0359800 PROTEIN (PUTATIVE UNCHARACTERIZED PROTEIN),OS01G0359800 PROTEIN (PUTATIVE UNCHARACTERIZED PROTEIN)

VSLVVGPLVSLVKEKASNYLLDKYKVMEGMEKQHEVLKRKLPAILDVIADAEKQASHQKGVKVWLGRLKTVAYQAIDIFDEFEYEALRRQAKKNGHITKLGKAGVKLFPTHNRVIFRIRMASKLQRVVGAIKVLVDQMNDFGFNRLQHQQAPALKEGRETDSNIVDPKNIVSRSRHEERKKIVEILVNDQATNGDLKVLPIVGMGGLGKTTLAQLIYNDPQVKDHFQLLKWVCVSDDFNLCNLANKICNASEGSLEKALKELQEQLKGKRYLLVLDDVWDEESFLDKWEKFKACLEQGGVGSAVLTTTRNTEIAQLMGTVGISHERKYLDVGNLGKEFIQEIIETRAFSLHKRDDELVNLVGPIAERCAGSPLAAKALGSILRKKTTTEEWEDVLQRSNICTVETGILPILKLSYDELPTDMKPCFAFCALYPKDYQIDVDNLIQLWMANGFIVFEQNKVPIETVGKRIVNEMVSRSLFEHVEQDPTKFGYSSTTFLKIHDLMHDVAVSATEDEYIYVTDEMDESGKLLPSATRHIHFETWEGQLFANIDILSIRTLLVVPGRYYRDELHSSKYSSLRALALPASYYKYLPMKPKNLHHLRYLDISKSTIKALPDDISILYNLQTLKLSGCEELSMLPKQMKYMTALCHLYTDGCTKLQCMPPELGRLTSLRTLTCFVVSSDSDCSSLGELKNLNIGGSLELKQLENVTEARNARQANLGNKKELRQLSLRWTSGKGEEQQCNEVLEVLEVHDRLLALEIEAYQGTNFPLWMGALRNMVELRLSDCSKSEQLPPLCQLPALQLLHLEGLTQLQFLCSSCTSSTFGKLKDLKLDYLPNFDRFYDQVVQEELVAFPQLEKLHIEGCRELTALPEAGVLRKWYDGGEYTMVRSAFPELKSLVLIDLWSFERWEAAIEIEVEHALFPLLETVRIYRCDKLTTLPRAPKLRELCLSMNYYKNQQRSLGATRYMTSLSNLKLERVEVDGKDKWDYISSVTNMHLDSCSLFFQSHALALWACFRQLQDLVIRRANDLIYWPENEFQNLVSLRRLYIGDCESLVGYAPDQATLERSQLLPCLESLSISFCDSLVEVFNPTPALKEMDVEYCKNLKTISFKQQDKTSLNAGHPSTDVIMASTAVQDLSPSAGRSNF

superfamily: SSF52540
158-402 P-loop containing nucleoside triphosphate hydrolases

ALKEGRETDSNIVDPKNIVSRSRHEERKKIVEILVNDQATNGDLKVLPIVGMGGLGKTTLAQLIYNDPQVKDHFQLLKWVCVSDDFNLCNLANKICNASEGSLEKALKELQEQLKGKRYLLVLDDVWDEESFLDKWEKFKACLEQGGVGSAVLTTTRNTEIAQLMGTVGISHERKYLDVGNLGKEFIQEIIETRAFSLHKRDDELVNLVGPIAERCAGSPLAAKALGSILRKKTTTEEWEDVLQR

HMMPfam: PF00931
IPR002182
185-460 NB-ARC,NBS
NB-ARC

KKIVEILVNDQATNGDLKVLPIVGMGGLGKTTLAQLIYNDPQVKDHFQLLKWVCVSDDFNLCNLANKICNASEGSLEKALKELQEQLKGKRYLLVLDDVWDEESFLDKWEKFKACLEQGGVGSAVLTTTRNTEIAQLMGTVGISHERKYLDVGNLGKEFIQEIIETRAFSLHKRDDELVNLVGPIAERCAGSPLAAKALGSILRKKTTTEEWEDVLQRSNICTVETGILPILKLSYDELPTDMKPCFAFCALYPKDYQIDVDNLIQLWMANGFIVF

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

VLPIVGMGGLGKTTLA

Seg: seg
260-274 seg

LEKALKELQEQLKGK

FPrintScan: PR00364
IPR000767
270-284 DISEASERSIST
Disease resistance protein

QLKGKRYLLVLDDVW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CAGSPLAAKALGSIL

superfamily: SSF52058
503-876 L domain-like,LRR

KIHDLMHDVAVSATEDEYIYVTDEMDESGKLLPSATRHIHFETWEGQLFANIDILSIRTLLVVPGRYYRDELHSSKYSSLRALALPASYYKYLPMKPKNLHHLRYLDISKSTIKALPDDISILYNLQTLKLSGCEELSMLPKQMKYMTALCHLYTDGCTKLQCMPPELGRLTSLRTLTCFVVSSDSDCSSLGELKNLNIGGSLELKQLENVTEARNARQANLGNKKELRQLSLRWTSGKGEEQQCNEVLEVLEVHDRLLALEIEAYQGTNFPLWMGALRNMVELRLSDCSKSEQLPPLCQLPALQLLHLEGLTQLQFLCSSCTSSTFGKLKDLKLDYLPNFDRFYDQVVQEELVAFPQLEKLHIEGCRELTALP

FPrintScan: PR00364
IPR000767
623-639 DISEASERSIST
Disease resistance protein

SILYNLQTLKLSGCEEL

Seg: seg
681-692 seg

CFVVSSDSDCSS

Gene3D: G3DSA:3.80.10.10
759-877 no description

RLLALEIEAYQGTNFPLWMGALRNMVELRLSDCSKSEQLPPLCQLPALQLLHLEGLTQLQFLCSSCTSSTFGKLKDLKLDYLPNFDRFYDQVVQEELVAFPQLEKLHIEGCRELTALPE

Seg: seg
796-820 seg

QLPPLCQLPALQLLHLEGLTQLQFL

HMMPfam: PF13504
859-876 LRR_7,Leucine rich repeat

PQLEKLHIEGCRELTALP

superfamily: SSF52047
898-1115 RNI-like,LRR

PELKSLVLIDLWSFERWEAAIEIEVEHALFPLLETVRIYRCDKLTTLPRAPKLRELCLSMNYYKNQQRSLGATRYMTSLSNLKLERVEVDGKDKWDYISSVTNMHLDSCSLFFQSHALALWACFRQLQDLVIRRANDLIYWPENEFQNLVSLRRLYIGDCESLVGYAPDQATLERSQLLPCLESLSISFCDSLVEVFNPTPALKEMDVEYCKNLKTIS

HMMPfam: PF05725
IPR008615
1150-1185 FNIP
FNIP

SNFLPSSLETLTIDECDGLLEVLNLPSSLKEIYISG

Gene3D: G3DSA:3.80.10.10
1154-1202 no description

PSSLETLTIDECDGLLEVLNLPSSLKEIYISGCSQLQILSGELDALSYL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox