PRGDB00181464 (Si027423m)

From PRG Wiki
Revision as of 22:40, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Si027423m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Setaria italica

Comment?

mla1, putative, expressed (best rice hit)

DNA Sequence

TGGATAGCTAAAGTGTTTATTCAGAATGAACAAGCAACAACAGAGATAGAACTATTTGAGCTCGGGGAAGGGTACTTCAACGAGCTAATAAATAGAAGCATGATCCAACCGATGGAGTTAGAGGATAACGGGTATGTATATGTTTGTGGTGTTCATGATATGGTACTTGATCTGGTTCGTTCACTATCGAGTGAAGAAAATTTGGCCACTATATTGGACAACAATGACCAACAAAAACTCATAGGCGGTAGCAATACTCGCAGATTTGCCGTGCACGGTAGGAGTGTTGAAGAGCACAACCGCACTCAGCTACTGCCGGAGGGTGTGCGCCTGTTGAAACAACTGTTGTGCCTACATGTCAATGACAGTATAATAGTGCCATCTTGTTTGATCAGGAACCTTACTTCGTTGCAAGAGCTCAAGCTCGTCAAGGACCTGACCATTCATGTAAACGATGAGAGCATGGAGAGAGATTTGCTGGAATCGCTTGCAAATCTCCACAAGATCCGCACCTTATGTGTTTTTGGCTCAGCATTGGTGAGAGGCATCACGGGTGAAGAAGCATGTTTTGAGGCTCTTCCTCTTCGTCTTGGACAGATGTGTTTGGAATGCTTCAAGTTCTCTGCACTACCGGTATGGATGGACTCGACACTTCTTTTGAACCTCACCCATCTGGATGTGACAGTGAATTTGGTGCAAGAACAGGACATGGAAACCCTTGGGAGGCTACCAGAGCTCTGTTATCTCAAACTGAGTTCAGATCACACCAAACTATTAAGCATAAGGAAGACCACTGGTGATCATCTGCACCGCTACTTCCGGAAGTTGAGATTCTTTCACACTCCCTTTTCGTTTGTCCAGTTTGATTCGCACAGCTGCGAAAGAGACAACGATGCAACCACAGCACCTTCCATCGTGATGCCAAGCCTTGAATCCCTTGTGTTTTCTGTTTATGTGCGGTTCATAAAAGATATGGACATTATTCAGCCTGGCTTTGAAAATGTTGCTGGTACTTCGCTCCAGAGGGTTACTGCTACGATCCAGCAGTGTGAGGACGCTACTGCTGCGGAGGTGGAGGAAGGGAAGGCAGCATTGGCACACGCAGCTGACCTCCATCCCAACTGTCCCACCCTTAGAATTGAGATGGAGAATAAGCATAAGATGCTCTCAACTGAACGAGAGGTACTTACCTATTGA


Protein sequences

Name Description Sequence
Si027423m mla1, putative, expressed (best rice hit)

WIAKVFIQNEQATTEIELFELGEGYFNELINRSMIQPMELEDNGYVYVCGVHDMVLDLVRSLSSEENLATILDNNDQQKLIGGSNTRRFAVHGRSVEEHNRTQLLPEGVRLLKQLLCLHVNDSIIVPSCLIRNLTSLQELKLVKDLTIHVNDESMERDLLESLANLHKIRTLCVFGSALVRGITGEEACFEALPLRLGQMCLECFKFSALPVWMDSTLLLNLTHLDVTVNLVQEQDMETLGRLPELCYLKLSSDHTKLLSIRKTTGDHLHRYFRKLRFFHTPFSFVQFDSHSCERDNDATTAPSIVMPSLESLVFSVYVRFIKDMDIIQPGFENVAGTSLQRVTATIQQCEDATAAEVEEGKAALAHAADLHPNCPTLRIEMENKHKMLSTEREVLTY*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
34-316 L domain-like,LRR

MIQPMELEDNGYVYVCGVHDMVLDLVRSLSSEENLATILDNNDQQKLIGGSNTRRFAVHGRSVEEHNRTQLLPEGVRLLKQLLCLHVNDSIIVPSCLIRNLTSLQELKLVKDLTIHVNDESMERDLLESLANLHKIRTLCVFGSALVRGITGEEACFEALPLRLGQMCLECFKFSALPVWMDSTLLLNLTHLDVTVNLVQEQDMETLGRLPELCYLKLSSDHTKLLSIRKTTGDHLHRYFRKLRFFHTPFSFVQFDSHSCERDNDATTAPSIVMPSLESLVFS

HMMPanther: PTHR23155:SF194
103-328 OS11G0130900 PROTEIN,OS11G0130900 PROTEIN

QLLPEGVRLLKQLLCLHVNDSIIVPSCLIRNLTSLQELKLVKDLTIHVNDESMERDLLESLANLHKIRTLCVFGSALVRGITGEEACFEALPLRLGQMCLECFKFSALPVWMDSTLLLNLTHLDVTVNLVQEQDMETLGRLPELCYLKLSSDHTKLLSIRKTTGDHLHRYFRKLRFFHTPFSFVQFDSHSCERDNDATTAPSIVMPSLESLVFSVYVRFIKDMDII

HMMPanther: PTHR23155
103-328 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QLLPEGVRLLKQLLCLHVNDSIIVPSCLIRNLTSLQELKLVKDLTIHVNDESMERDLLESLANLHKIRTLCVFGSALVRGITGEEACFEALPLRLGQMCLECFKFSALPVWMDSTLLLNLTHLDVTVNLVQEQDMETLGRLPELCYLKLSSDHTKLLSIRKTTGDHLHRYFRKLRFFHTPFSFVQFDSHSCERDNDATTAPSIVMPSLESLVFSVYVRFIKDMDII






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox