PRGDB00181476 (Si027736m)

From PRG Wiki
Revision as of 22:39, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Si027736m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); disease resistance protein RPM1, putative (best rice hit)

DNA Sequence

ATGGCGGAGGCTGTGGTAGGAGTGCTGATGGGCAAGCTCGGTGCGGCCTTGGCGAATGAGGCAGCAACCTATGGTGCATCCCTTCTGTTCAAGGAAGCTTCTTCCCTCAAGGGTCTCTTCAGTGAGATCCGTAAAGCGGAGGGGGAGATGGAGAGCATCAAGGCCTACCTGCGTGAGTCAGAGAAGCTCAGGGATGCCGATGAGACCACTGGCATCTTCGTCAACAAGATCCGGGAACTATCTTTTCGGATCGAGGATGTCGTTGACGAGTTCATGTACAAACTTGAGGACAACAAGCTTGGAGGATTTGCAGCCAAGACGAAGAAGAGGATCAAGCATGTCAAGGTTTGGCATCGCCTAGCTCTCCAGCTCCGTGATATTAATGTCGAGATTGAAGATGCTACAAAAAGGAGGGACCGTTATGTCATCCCGGGAATGGAGAGACATGCTGGAAACAGTGACCATCATGCTAGATCCACCAATCAAGCTTTGTGTTTTGCAAGGGAAGAGGATCTAGTGGGTATTAAAGGTAATGCAGCCAAGCTCAAGGGGTGGCTAGTGGATGATTTGGATGAAAGGAACACCAAAATCACCACAGTATGGGGGATGGGCGGAGTAGGTAAAACTACTTTAGTTGATCATGTCTACAAGATTGTGAAACTGGATTTTGACGCTGCTGCATGGGTAACTGTGTCCAAGAGTTACCAAGTTGACGATTTGCTGAAGAAAATTGCTAGACAGTTCGGCATCTCAATTGCTAGCAATATGGAAATGATAAGAGTAGTTGATAGCTCTATCCGTAACCATCTCGAAGGTAAAAGGTACATCTTGGTTCTTGATGATATTTGGGAACAAGATATGTGGATCAATAATATCATGCCTATCTTTCCGACTAATTGTTCTGGTAGATTTGTTCTCACATCAAGATCATCTGAAGTTGCATCTGTAGCAACACGAGCAAATCACTCCAGGAAGTTATTCTGCAACGAAGCTTTTTGGAACAGTGATGACAAAAGGTGCCCACCAGAGTTACTTGATTTGGCTGAGTTAGAATCGTACTCAACTAATAATGCGATCAAGAGTGTGGATACGATTTTGAGAGTTAGCTTGGAGGATCTTCCATCTGAATTGAAGAATTGCTTCTTGCATTGTGCCATGTTTCCAGAGGACTATCAAATCAAGAGGAGGAGGTTAACTAGGCACTGGATTACTTCTGGATTCATCAGGAAAAAGGGGAACAAAACACTAGAACAAGTGGCAGAGGGCTACTTGAATGATCTTGTCAACCGAAATCTGCTACAAGTTGTGAGGAAGAATGAGGCTGGACGAGTGAAAAGTTGCCGAATCCATGATGTCATCCACCATCTTGCTATTGACAAAGCGGAGGAAGAATGCTTTGGTAAAGTTTACAAGGGCAATGGGACATTTTCGGTACACGGAACGCGGAGACTGTCAATACAGAGTATCAATATTGTACCACAGAATCAATCTGATGCAACACATCTCCGTGCAGTCTATGTTTTTGAGAGTTCTATTGATGTTGATTTGTTGGGGACTATTCTTGCATCTTCAACATTGTTGTCAACATTGGATCTGCAAGGTACTCAAATCAAGATGCTGCCTAATGAGGCGTTCAACTTGTTCAATCTGCGTTTTTTGGGTCTTCGAAATACTCGAATTGAGAGTCTACCAGAGGCTGTTGGAAGATTGCAAAACTTAGAAGTATTGGACGCATCATGTACTCTTCTGCAATCTTTACCAAAGGATGTAGCGAAACTAAAGAAGCTTAGGTACTTGTATGCACCTGAACTTCTTGTGCCTCGGGACATAAGGAATTTGACAGGACTTCATGCTCTACAAAGTGTTAAAGCAAGCAAGGAGACTCTACGTGATGTTGCAGCATTGACAGAATTAAGAACATTTGATGTTAGCGATGTGACAAGTGAGCACTCCATAAACTTGTGTACTGCTATATCGAATATGTCCCATCTTGCCCATCTAACTGTTTGGGCATTGAACGAAAATGAAGTATTACCGATGGAAGCACTCCGTTTACCAGAGACTCTTTATAGACTTGAACTGAGAGGGCAGCTGGAGAAGACACAGATTCCTCAGATTTTCTCATCCTGGTCGAACCTGAACAACCTCACTAAATTGCAGCTGATGTCTTCCAAACTTAACGAGGACTCCTTTTCTAGCCTCGTGACGTTACGCAGTTTATGCAGTCTTAGTCTTTATGGGGCTTATGATGGAAGA


Protein sequences

Name Description Sequence
Si027736m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); disease resistance protein RPM1, putative (best rice hit)

MAEAVVGVLMGKLGAALANEAATYGASLLFKEASSLKGLFSEIRKAEGEMESIKAYLRESEKLRDADETTGIFVNKIRELSFRIEDVVDEFMYKLEDNKLGGFAAKTKKRIKHVKVWHRLALQLRDINVEIEDATKRRDRYVIPGMERHAGNSDHHARSTNQALCFAREEDLVGIKGNAAKLKGWLVDDLDERNTKITTVWGMGGVGKTTLVDHVYKIVKLDFDAAAWVTVSKSYQVDDLLKKIARQFGISIASNMEMIRVVDSSIRNHLEGKRYILVLDDIWEQDMWINNIMPIFPTNCSGRFVLTSRSSEVASVATRANHSRKLFCNEAFWNSDDKRCPPELLDLAELESYSTNNAIKSVDTILRVSLEDLPSELKNCFLHCAMFPEDYQIKRRRLTRHWITSGFIRKKGNKTLEQVAEGYLNDLVNRNLLQVVRKNEAGRVKSCRIHDVIHHLAIDKAEEECFGKVYKGNGTFSVHGTRRLSIQSINIVPQNQSDATHLRAVYVFESSIDVDLLGTILASSTLLSTLDLQGTQIKMLPNEAFNLFNLRFLGLRNTRIESLPEAVGRLQNLEVLDASCTLLQSLPKDVAKLKKLRYLYAPELLVPRDIRNLTGLHALQSVKASKETLRDVAALTELRTFDVSDVTSEHSINLCTAISNMSHLAHLTVWALNENEVLPMEALRLPETLYRLELRGQLEKTQIPQIFSSWSNLNNLTKLQLMSSKLNEDSFSSLVTLRSLCSLSLYGAYDGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF125
14-752 PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN),PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN)

GAALANEAATYGASLLFKEASSLKGLFSEIRKAEGEMESIKAYLRESEKLRDADETTGIFVNKIRELSFRIEDVVDEFMYKLEDNKLGGFAAKTKKRIKHVKVWHRLALQLRDINVEIEDATKRRDRYVIPGMERHAGNSDHHARSTNQALCFAREEDLVGIKGNAAKLKGWLVDDLDERNTKITTVWGMGGVGKTTLVDHVYKIVKLDFDAAAWVTVSKSYQVDDLLKKIARQFGISIASNMEMIRVVDSSIRNHLEGKRYILVLDDIWEQDMWINNIMPIFPTNCSGRFVLTSRSSEVASVATRANHSRKLFCNEAFWNSDDKRCPPELLDLAELESYSTNNAIKSVDTILRVSLEDLPSELKNCFLHCAMFPEDYQIKRRRLTRHWITSGFIRKKGNKTLEQVAEGYLNDLVNRNLLQVVRKNEAGRVKSCRIHDVIHHLAIDKAEEECFGKVYKGNGTFSVHGTRRLSIQSINIVPQNQSDATHLRAVYVFESSIDVDLLGTILASSTLLSTLDLQGTQIKMLPNEAFNLFNLRFLGLRNTRIESLPEAVGRLQNLEVLDASCTLLQSLPKDVAKLKKLRYLYAPELLVPRDIRNLTGLHALQSVKASKETLRDVAALTELRTFDVSDVTSEHSINLCTAISNMSHLAHLTVWALNENEVLPMEALRLPETLYRLELRGQLEKTQIPQIFSSWSNLNNLTKLQLMSSKLNEDSFSSLVTLRSLCSLSLYGAYDGR

HMMPanther: PTHR23155
14-752 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GAALANEAATYGASLLFKEASSLKGLFSEIRKAEGEMESIKAYLRESEKLRDADETTGIFVNKIRELSFRIEDVVDEFMYKLEDNKLGGFAAKTKKRIKHVKVWHRLALQLRDINVEIEDATKRRDRYVIPGMERHAGNSDHHARSTNQALCFAREEDLVGIKGNAAKLKGWLVDDLDERNTKITTVWGMGGVGKTTLVDHVYKIVKLDFDAAAWVTVSKSYQVDDLLKKIARQFGISIASNMEMIRVVDSSIRNHLEGKRYILVLDDIWEQDMWINNIMPIFPTNCSGRFVLTSRSSEVASVATRANHSRKLFCNEAFWNSDDKRCPPELLDLAELESYSTNNAIKSVDTILRVSLEDLPSELKNCFLHCAMFPEDYQIKRRRLTRHWITSGFIRKKGNKTLEQVAEGYLNDLVNRNLLQVVRKNEAGRVKSCRIHDVIHHLAIDKAEEECFGKVYKGNGTFSVHGTRRLSIQSINIVPQNQSDATHLRAVYVFESSIDVDLLGTILASSTLLSTLDLQGTQIKMLPNEAFNLFNLRFLGLRNTRIESLPEAVGRLQNLEVLDASCTLLQSLPKDVAKLKKLRYLYAPELLVPRDIRNLTGLHALQSVKASKETLRDVAALTELRTFDVSDVTSEHSINLCTAISNMSHLAHLTVWALNENEVLPMEALRLPETLYRLELRGQLEKTQIPQIFSSWSNLNNLTKLQLMSSKLNEDSFSSLVTLRSLCSLSLYGAYDGR

Coil: coil
43-64 coiled-coil

IRKAEGEMESIKAYLRESEKLR

superfamily: SSF52540
155-315 P-loop containing nucleoside triphosphate hydrolases

HHARSTNQALCFAREEDLVGIKGNAAKLKGWLVDDLDERNTKITTVWGMGGVGKTTLVDHVYKIVKLDFDAAAWVTVSKSYQVDDLLKKIARQFGISIASNMEMIRVVDSSIRNHLEGKRYILVLDDIWEQDMWINNIMPIFPTNCSGRFVLTSRSSEVAS

Gene3D: G3DSA:3.40.50.300
180-284 no description

AKLKGWLVDDLDERNTKITTVWGMGGVGKTTLVDHVYKIVKLDFDAAAWVTVSKSYQVDDLLKKIARQFGISIASNMEMIRVVDSSIRNHLEGKRYILVLDDIWE

HMMPfam: PF00931
IPR002182
181-326 NB-ARC,NBS
NB-ARC

KLKGWLVDDLDERNTKITTVWGMGGVGKTTLVDHVYKIVKLDFDAAAWVTVSKSYQVDDLLKKIARQFGISIASNMEMIRVVDSSIRNHLEGKRYILVLDDIWEQDMWINNIMPIFPTNCSGRFVLTSRSSEVASVATRANHSRKL

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

ITTVWGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

HLEGKRYILVLDDIW

HMMPfam: PF00931
IPR002182
358-410 NB-ARC,NBS
NB-ARC

AIKSVDTILRVSLEDLPSELKNCFLHCAMFPEDYQIKRRRLTRHWITSGFIRK

superfamily: SSF52047
488-751 RNI-like,LRR

SINIVPQNQSDATHLRAVYVFESSIDVDLLGTILASSTLLSTLDLQGTQIKMLPNEAFNLFNLRFLGLRNTRIESLPEAVGRLQNLEVLDASCTLLQSLPKDVAKLKKLRYLYAPELLVPRDIRNLTGLHALQSVKASKETLRDVAALTELRTFDVSDVTSEHSINLCTAISNMSHLAHLTVWALNENEVLPMEALRLPETLYRLELRGQLEKTQIPQIFSSWSNLNNLTKLQLMSSKLNEDSFSSLVTLRSLCSLSLYGAYDG

Seg: seg
516-532 seg

LLGTILASSTLLSTLDL

Gene3D: G3DSA:3.80.10.10
522-622 no description

ASSTLLSTLDLQGTQIKMLPNEAFNLFNLRFLGLRNTRIESLPEAVGRLQNLEVLDASCTLLQSLPKDVAKLKKLRYLYAPELLVPRDIRNLTGLHALQSV

Seg: seg
545-559 seg

FNLFNLRFLGLRNTR

HMMPfam: PF13855
549-600 LRR_8,Leucine rich repeat

NLRFLGLRNTRIESLPEAVGRLQNLEVLDASCTLLQSLPKDVAKLKKLRYLY

Gene3D: G3DSA:3.80.10.10
623-748 no description

KASKETLRDVAALTELRTFDVSDVTSEHSINLCTAISNMSHLAHLTVWALNENEVLPMEALRLPETLYRLELRGQLEKTQIPQIFSSWSNLNNLTKLQLMSSKLNEDSFSSLVTLRSLCSLSLYGA

FPrintScan: PR00364
IPR000767
633-649 DISEASERSIST
Disease resistance protein

AALTELRTFDVSDVTSE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox