PRGDB00181890 (108818)

From PRG Wiki
Revision as of 22:27, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
108818
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

CCCATTGCTGTGTCGCCAATCCCAGTCGAGGAGGTGTCGGAGAGCACCGAGAATTTCGACCAGAGCCATCTCATTGGAGAGGGCTCGTATGGTCGAGTTTATCTTGCAAAGCTGCGCAATGGGCAGTCCGTGGCTCTCAAGAAGCTCGATTCGAGCCCGCAACTGCATGAGGACTTCGTCTCTCAGGTGTCAAGGCAGTCGAGGCTCAAACACGAGAATATGGTGGAGCTCCTTGGATACTGCATTGACGGCCCTCTGCGTGTTCTCGCGTTTGAGTTCGCGGAGATGGGATCTCTCCATGATATTCTTCACGGCAGGAAAGGTGTGCTTGGATCGAGGCCAGGGCCTGTGCTGGACTGGATGCAAAGAGTAAAGATTGCGGTTGGAGCGGCCAGAGGGCTAGAGTATTTGCACGAGAAGGCCCAGCCACCAGTCGTCCACCGAGACATCAAGTCGAGCAACGTCTTGCTGTTCGAGAACTACGCAGCTAAGATTGGAGACTACAACCCGAGCAACCAGGCACCGGACATGGCTTCACGGCTGCATTCGACTCGGGTTCTGGGATCATTCGGCTACCACGCACCAGAGTATGCGATGACCGGGCAATTAACTCAGAAGAGCGATGTCTACAGCTTTGGAGTTGTTCTTCTGGAGCTTCTCACGGGAAGGAGGCCAGTTGATCCTTCAATGCCTCGGGGCCAGCAAAGTCTGGTGACATGGGCAACGCCGAGGCTGACCGAAGACAAAGTGACGCAGTGCGCGGATCCAAATCTCAAGGGAGAGTACCCTCCTAAGGGCCTGGCCAAATTTGCTGCAGTTGCTGCCTTGTGTGTCCAATACGAAGCCAACTTCCGGCCAAGCATGAGCATTGTGGTCACATTTTTCCTATTCAGTATTATCAGCTATAAGCCCCATTGCATCTACAATTTGTTGAAATGTGTCATAATAAATATTGTTAACTGTCTTGAGATCTTTGAAAGACTAAGCACCTTTTTTATGGAGTAA


Protein sequences

Name Description Sequence
108818 Protein kinase superfamily protein (best arabidopsis hit)

PIAVSPIPVEEVSESTENFDQSHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVVTFFLFSIISYKPHCIYNLLKCVIINIVNCLEIFERLSTFFME*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-292 PTHR24420,FAMILY NOT NAMED

PIAVSPIPVEEVSESTENFDQSHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVV

HMMPanther: PTHR24420:SF416
1-292 PTHR24420:SF416,SUBFAMILY NOT NAMED

PIAVSPIPVEEVSESTENFDQSHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVV

Gene3D: G3DSA:3.30.200.20
7-93 G3DSA:3.30.200.20

IPVEEVSESTENFDQSHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEF

superfamily: SSF56112
IPR011009
8-323 Kinase_like
Protein kinase-like domain

PVEEVSESTENFDQSHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVVTFFLFSIISYKPHCIYNLLKCVIINIVNCLE

ProfileScan: PS50011
IPR000719
19-297 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDQSHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVVTFFLF

HMMPfam: PF07714
IPR001245
22-293 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SHLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQLHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVVT

PatternScan: PS00107
IPR017441
25-47 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYLAKLRNGQSVALK

Gene3D: G3DSA:1.10.510.10
97-292 G3DSA:1.10.510.10

GSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEANFRPSMSIVV

PatternScan: PS00108
IPR008271
145-157 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox