PRGDB00182408 (106138)

From PRG Wiki
Revision as of 22:11, 5 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
106138
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Selaginella moellendorffii

Comment?

Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

DNA Sequence

CAGCTGGAGTACCTTCGTTATCTCGATCTCTCCACGGTCCAGCTCTCCATGGCCATTCCTCCGGAGATAGGCTCCATGATGGGTCTCGAGGCTCTTTCGCTGGCGGGGAGCTCACTTATGGGACAGTTGCCGACGAACATCAGCAACCTCGTTAGCCTGCGGCATTTGGACCTGTCGAGCAATCCCCTCGGCATAAGAATCCCCACAAGCTTGTGTGACTTACAGAACCTTGAGCACCTCTCGCTCAATCACTCCCAGTTTCACGGCGCCGTTCCGCAAAGTATCTGCGACGCCACCAGTCTCGAGCAGCTCGACTTGTCCAGGTCCATGAGCTTGAGTGCCACACTTCCAGACTGCTTCTTCGATCTCACCGCGCTCAAGTATCTGGACCTGTCAGGAAACATGCTCATGGGCTCAATATCGGACTCCATTGGAAACTTCAAACGTCTCACTTACCTCAGTCTCGACGGGAATCAGTTCACCGGTGGAATACCGTATGGAATCAGCGACCTTTCCAGTCTCGTCATTCTTGACATGGTGGACATGTTTGACGAAAATGCAAGAACTTCCATCCCTTCGTTTCTTGGAGAGCTCACCAATCTTCGAGTTCTTCGGCTCAGTGGTCGTGCATGGCGAGGTGCCATTCCCAGCAGTAGCATCCAGAACCTCACCAGCCTGCAGGAGATGATAATCACGACCGCACCTTATATTAATGGGCCGCTTCCTTCCGAGCTTGCTGGTCTCACCACCTTACAGACGCTGATAATCACCGGTACAACTGTCTGGGGTAGCATTCCCTCCGAGCTCGGGAACCTTCCGCAGCTGCGAGTCCTCGACCTCTCAAGCAACATGCTGTCTGGTAGCATTCCTCGGAACCTTGGGAGACTTCAGACGCTTCGGGAGCTCCAACTGGCATCAAACAATCTTAGTGGAAGCATTCCCTGGGAGCTTGGAAGTATTCGCAGAGCTTACCTTGTGAACCTGGCAAACAACTCCTTGTCCGGCCAGATTCCCGACTCGCTGGCAAACATCGCCCCATCAGGAAGTGTGTTGGACATCTCCAACAACAATCTCAGCGGGCCGATACCAAGCTGGCTGTCTCAGCAAAGTGCCTTGGACACGCTGGATTTGTCGCAGAACAACCTCTCTGGAGACGTTCCATCCTGGATAAGCACAGCGACGCGGTTAACCCTCACTGCTGTAGACTTCTCCAACAATCACTTCTCCGGAGAAATCCCGACGGAGCTAGCAGGCCTGGTAGGACTGACGAGTCTCAACCTGTCTCGCAATGATCTCTCCGGAGAAATCCCAACGAGCATCTCCAACGGCAACGCACTCCAGCTGATTGATCTCAGCAGGAACACACTGGACGGGACGATCCCTCCGGAGATTGGTGACCTGTATATGCTCGAGATGCTGGATCTCTCGTACAACCAGCTTTCCGGAAGCATCCCGACCGCACTGGACGACCTTCTCTCGCTCGCGGCTTTTAACGTGTCGGCCAACAATCTCACCGGAGCTATTCCTCAAGCCGGGGGCATCCACAACCTCTTCCAGAGATTCTCCAAGCTCGAGTTCCTGGACCTGTCCCAGAATTTTCTCATCGGCGCGATACCATCGTCGCTAGGCGCCATGGCTTCCCTCGAGGAGATCTATCTCTACAGCAACAACCTCAACGGCTCCATCCCCGACGCCATCGCCAATCTCACCCGCCTCGCGACGCTGGATCTCTCCAGCAATCACCTCGATGGCCAAATCCCCGGCCCAGCGATCGCGCAGCTCACGGGGTTGCAAGTGATGGATCTCTCCGCGAACGATCTCACCGGAAATATTCCATCGGAGCTCGCGGATCTCGGCCAGCTCGCGACGCTCGATCTGTCCTGGAACCAGCTCTCCGGAGTGATCCCGCCCGAAATCCACGATCTCTCATCGCTGGAGTACTTCAGCGTCGCGAACAACAATCTCTCCGGCCCCATCCCGGCGGAGCTCGGGAGCTTCGATGCCTCGTCCTTCGAGGACAATGCTGGACTGTGTGGATTCCCGCTAGATCCGTGCTCAAGCTAG


Protein sequences

Name Description Sequence
106138 Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

QLEYLRYLDLSTVQLSMAIPPEIGSMMGLEALSLAGSSLMGQLPTNISNLVSLRHLDLSSNPLGIRIPTSLCDLQNLEHLSLNHSQFHGAVPQSICDATSLEQLDLSRSMSLSATLPDCFFDLTALKYLDLSGNMLMGSISDSIGNFKRLTYLSLDGNQFTGGIPYGISDLSSLVILDMVDMFDENARTSIPSFLGELTNLRVLRLSGRAWRGAIPSSSIQNLTSLQEMIITTAPYINGPLPSELAGLTTLQTLIITGTTVWGSIPSELGNLPQLRVLDLSSNMLSGSIPRNLGRLQTLRELQLASNNLSGSIPWELGSIRRAYLVNLANNSLSGQIPDSLANIAPSGSVLDISNNNLSGPIPSWLSQQSALDTLDLSQNNLSGDVPSWISTATRLTLTAVDFSNNHFSGEIPTELAGLVGLTSLNLSRNDLSGEIPTSISNGNALQLIDLSRNTLDGTIPPEIGDLYMLEMLDLSYNQLSGSIPTALDDLLSLAAFNVSANNLTGAIPQAGGIHNLFQRFSKLEFLDLSQNFLIGAIPSSLGAMASLEEIYLYSNNLNGSIPDAIANLTRLATLDLSSNHLDGQIPGPAIAQLTGLQVMDLSANDLTGNIPSELADLGQLATLDLSWNQLSGVIPPEIHDLSSLEYFSVANNNLSGPIPAELGSFDASSFEDNAGLCGFPLDPCSS*


Domains

Domain Start-End Description Sequence

superfamily: SSF52047
1-343 SSF52047,LRR

QLEYLRYLDLSTVQLSMAIPPEIGSMMGLEALSLAGSSLMGQLPTNISNLVSLRHLDLSSNPLGIRIPTSLCDLQNLEHLSLNHSQFHGAVPQSICDATSLEQLDLSRSMSLSATLPDCFFDLTALKYLDLSGNMLMGSISDSIGNFKRLTYLSLDGNQFTGGIPYGISDLSSLVILDMVDMFDENARTSIPSFLGELTNLRVLRLSGRAWRGAIPSSSIQNLTSLQEMIITTAPYINGPLPSELAGLTTLQTLIITGTTVWGSIPSELGNLPQLRVLDLSSNMLSGSIPRNLGRLQTLRELQLASNNLSGSIPWELGSIRRAYLVNLANNSLSGQIPDSLAN

Gene3D: G3DSA:3.80.10.10
2-199 G3DSA:3.80.10.10

LEYLRYLDLSTVQLSMAIPPEIGSMMGLEALSLAGSSLMGQLPTNISNLVSLRHLDLSSNPLGIRIPTSLCDLQNLEHLSLNHSQFHGAVPQSICDATSLEQLDLSRSMSLSATLPDCFFDLTALKYLDLSGNMLMGSISDSIGNFKRLTYLSLDGNQFTGGIPYGISDLSSLVILDMVDMFDENARTSIPSFLGELT

HMMPanther: PTHR24420:SF474
8-679 PTHR24420:SF474,SUBFAMILY NOT NAMED

LDLSTVQLSMAIPPEIGSMMGLEALSLAGSSLMGQLPTNISNLVSLRHLDLSSNPLGIRIPTSLCDLQNLEHLSLNHSQFHGAVPQSICDATSLEQLDLSRSMSLSATLPDCFFDLTALKYLDLSGNMLMGSISDSIGNFKRLTYLSLDGNQFTGGIPYGISDLSSLVILDMVDMFDENARTSIPSFLGELTNLRVLRLSGRAWRGAIPSSSIQNLTSLQEMIITTAPYINGPLPSELAGLTTLQTLIITGTTVWGSIPSELGNLPQLRVLDLSSNMLSGSIPRNLGRLQTLRELQLASNNLSGSIPWELGSIRRAYLVNLANNSLSGQIPDSLANIAPSGSVLDISNNNLSGPIPSWLSQQSALDTLDLSQNNLSGDVPSWISTATRLTLTAVDFSNNHFSGEIPTELAGLVGLTSLNLSRNDLSGEIPTSISNGNALQLIDLSRNTLDGTIPPEIGDLYMLEMLDLSYNQLSGSIPTALDDLLSLAAFNVSANNLTGAIPQAGGIHNLFQRFSKLEFLDLSQNFLIGAIPSSLGAMASLEEIYLYSNNLNGSIPDAIANLTRLATLDLSSNHLDGQIPGPAIAQLTGLQVMDLSANDLTGNIPSELADLGQLATLDLSWNQLSGVIPPEIHDLSSLEYFSVANNNLSGPIPAELGSFDASSFEDNAGLCG

HMMPanther: PTHR24420
8-679 PTHR24420,FAMILY NOT NAMED

LDLSTVQLSMAIPPEIGSMMGLEALSLAGSSLMGQLPTNISNLVSLRHLDLSSNPLGIRIPTSLCDLQNLEHLSLNHSQFHGAVPQSICDATSLEQLDLSRSMSLSATLPDCFFDLTALKYLDLSGNMLMGSISDSIGNFKRLTYLSLDGNQFTGGIPYGISDLSSLVILDMVDMFDENARTSIPSFLGELTNLRVLRLSGRAWRGAIPSSSIQNLTSLQEMIITTAPYINGPLPSELAGLTTLQTLIITGTTVWGSIPSELGNLPQLRVLDLSSNMLSGSIPRNLGRLQTLRELQLASNNLSGSIPWELGSIRRAYLVNLANNSLSGQIPDSLANIAPSGSVLDISNNNLSGPIPSWLSQQSALDTLDLSQNNLSGDVPSWISTATRLTLTAVDFSNNHFSGEIPTELAGLVGLTSLNLSRNDLSGEIPTSISNGNALQLIDLSRNTLDGTIPPEIGDLYMLEMLDLSYNQLSGSIPTALDDLLSLAAFNVSANNLTGAIPQAGGIHNLFQRFSKLEFLDLSQNFLIGAIPSSLGAMASLEEIYLYSNNLNGSIPDAIANLTRLATLDLSSNHLDGQIPGPAIAQLTGLQVMDLSANDLTGNIPSELADLGQLATLDLSWNQLSGVIPPEIHDLSSLEYFSVANNNLSGPIPAELGSFDASSFEDNAGLCG

HMMPfam: PF00560
IPR001611
52-73 LRR_1
Leucine-rich repeat

SLRHLDLSSNPLGIRIPTSLCD

HMMPfam: PF13855
100-159 LRR_8,Leucine rich repeat

SLEQLDLSRSMSLSATLPDCFFDLTALKYLDLSGNMLMGSISDSIGNFKRLTYLSLDGNQ

Gene3D: G3DSA:3.80.10.10
200-335 G3DSA:3.80.10.10

NLRVLRLSGRAWRGAIPSSSIQNLTSLQEMIITTAPYINGPLPSELAGLTTLQTLIITGTTVWGSIPSELGNLPQLRVLDLSSNMLSGSIPRNLGRLQTLRELQLASNNLSGSIPWELGSIRRAYLVNLANNSLSG

HMMPfam: PF00560
IPR001611
274-296 LRR_1
Leucine-rich repeat

QLRVLDLSSNMLSGSIPRNLGRL

superfamily: SSF52058
320-397 SSF52058,LRR

IRRAYLVNLANNSLSGQIPDSLANIAPSGSVLDISNNNLSGPIPSWLSQQSALDTLDLSQNNLSGDVPSWISTATRLT

Gene3D: G3DSA:3.80.10.10
336-517 G3DSA:3.80.10.10

QIPDSLANIAPSGSVLDISNNNLSGPIPSWLSQQSALDTLDLSQNNLSGDVPSWISTATRLTLTAVDFSNNHFSGEIPTELAGLVGLTSLNLSRNDLSGEIPTSISNGNALQLIDLSRNTLDGTIPPEIGDLYMLEMLDLSYNQLSGSIPTALDDLLSLAAFNVSANNLTGAIPQAGGIHNL

HMMPfam: PF00560
IPR001611
350-367 LRR_1
Leucine-rich repeat

VLDISNNNLSGPIPSWLS

superfamily: SSF52058
398-660 SSF52058,LRR

LTAVDFSNNHFSGEIPTELAGLVGLTSLNLSRNDLSGEIPTSISNGNALQLIDLSRNTLDGTIPPEIGDLYMLEMLDLSYNQLSGSIPTALDDLLSLAAFNVSANNLTGAIPQAGGIHNLFQRFSKLEFLDLSQNFLIGAIPSSLGAMASLEEIYLYSNNLNGSIPDAIANLTRLATLDLSSNHLDGQIPGPAIAQLTGLQVMDLSANDLTGNIPSELADLGQLATLDLSWNQLSGVIPPEIHDLSSLEYFSVANNNLSGPIP

HMMPfam: PF13855
422-480 LRR_8,Leucine rich repeat

LTSLNLSRNDLSGEIPTSISNGNALQLIDLSRNTLDGTIPPEIGDLYMLEMLDLSYNQL

FPrintScan: PR00019
470-483 LEURICHRPT,Leucine-rich repeat signature

LEMLDLSYNQLSGS

Gene3D: G3DSA:3.80.10.10
518-665 G3DSA:3.80.10.10

FQRFSKLEFLDLSQNFLIGAIPSSLGAMASLEEIYLYSNNLNGSIPDAIANLTRLATLDLSSNHLDGQIPGPAIAQLTGLQVMDLSANDLTGNIPSELADLGQLATLDLSWNQLSGVIPPEIHDLSSLEYFSVANNNLSGPIPAELGS

HMMPfam: PF13855
522-582 LRR_8,Leucine rich repeat

SKLEFLDLSQNFLIGAIPSSLGAMASLEEIYLYSNNLNGSIPDAIANLTRLATLDLSSNHL

FPrintScan: PR00019
569-582 LEURICHRPT,Leucine-rich repeat signature

LTRLATLDLSSNHL

HMMPfam: PF00560
IPR001611
621-640 LRR_1
Leucine-rich repeat

LATLDLSWNQLSGVIPPEIH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox