PRGDB00186594 ()

From PRG Wiki
Revision as of 09:10, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

DNA Sequence


Protein sequences

Name Description Sequence
Probable disease resistance protein At5g63020 RecName: Full=Probable disease resistance protein At5g63020; AltName: Full=pNd11.

MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKILSEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKRVMKMIEEVEVLRYQGDFAVVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKAFPENIDADGYEISF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-878 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKILSEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKRVMKMIEEVEVLRYQGDFAVVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKAFPEN

HMMPanther: PTHR23155:SF108
1-878 PTHR23155:SF108,SUBFAMILY NOT NAMED

MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKILSEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKRVMKMIEEVEVLRYQGDFAVVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKAFPEN

superfamily: SSF52540
137-382 SSF52540

VVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAE

HMMPfam: PF00931
IPR002182
160-440 NB-ARC,NBS
NB-ARC

PMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRN

Gene3D: G3DSA:3.40.50.300
166-267 G3DSA:3.40.50.300

WNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWS

FPrintScan: PR00364
IPR000767
176-191 DISEASERSIST
Disease resistance protein

ILGLHGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
252-266 DISEASERSIST
Disease resistance protein

VLKHKRFVLLLDDIW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
470-842 SSF52058,LRR

KMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPR

Gene3D: G3DSA:3.80.10.10
500-837 G3DSA:3.80.10.10

QSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNF

HMMPfam: PF13855
533-593 LRR_8,Leucine rich repeat

PQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRI

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

RLMPMLVVLDLSMNRDL


List of References

S Sato, T Kaneko, H Kotani, Y Nakamura, E Asamizu, N Miyajima, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones.
DNA Res.: 1998, 5(1);41-54
PubMed:9628582 WorldCat.org (P p)

Kayoko Yamada, Jun Lim, Joseph M Dale, Huaming Chen, Paul Shinn, Curtis J Palm, Audrey M Southwick, Hank C Wu, Christopher Kim, Michelle Nguyen, Paul Pham, Rosa Cheuk, George Karlin-Newmann, Shirley X Liu, Bao Lam, Hitomi Sakano, Troy Wu, Guixia Yu, Molly Miranda, Hong L Quach, Matthew Tripp, Charlie H Chang, Jeong M Lee, Mitsue Toriumi, Marie M H Chan, Carolyn C Tang, Courtney S Onodera, Justine M Deng, Kenji Akiyama, Yasser Ansari, Takahiro Arakawa, Jenny Banh, Fumika Banno, Leah Bowser, Shelise Brooks, Piero Carninci, Qimin Chao, Nathan Choy, Akiko Enju, Andrew D Goldsmith, Mani Gurjal, Nancy F Hansen, Yoshihide Hayashizaki, Chanda Johnson-Hopson, Vickie W Hsuan, Kei Iida, Meagan Karnes, Shehnaz Khan, Eric Koesema, Junko Ishida, Paul X Jiang, Ted Jones, Jun Kawai, Asako Kamiya, Cristina Meyers, Maiko Nakajima, Mari Narusaka, Motoaki Seki, Tetsuya Sakurai, Masakazu Satou, Racquel Tamse, Maria Vaysberg, Erika K Wallender, Cecilia Wong, Yuki Yamamura, Shiaulou Yuan, Kazuo Shinozaki, Ronald W Davis, Athanasios Theologis, Joseph R Ecker
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science: 2003, 302(5646);842-6
PubMed:14593172 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox