PRGDB00186623 ()

From PRG Wiki
Revision as of 09:10, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 335355788 (HM446519)
Gene Class NL
Domain Type NBS, LRR
Gene Species Mangifera indica

Comment?

Mangifera indica NBS-LRR disease resistance protein (MRNBS13) gene, exon and partial cds.

DNA Sequence

GGTATGGGGGGTATTGGGAAAACCACTCTGGCTAAAAAGCTTTACCACAACAGTGCAGTCGTGAATAAATTCCATCGTCGAGCTTGGGTTTCCGTTTCTCAAGATTACAAAACAGAAGATCTTCTTCGGAGAATTATAAAATCATTTCGGATTAGCTATTCGACTATTGAGTTAGAAAAGATGAGTACAGAAGATCTGGAGAGACATCTTCACGGTTCATTGCTGGAACACTCATACCTGGTTGTGCTTGATGATGTTTGG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein, partial [Mangifera indica].

GMGGIGKTTLAKKLYHNSAVVNKFHRRAWVSVSQDYKTEDLLRRIIKSFRISYSTIELEKMSTEDLERHLHGSLLEHSYLVVLDDVW


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-87 NB-ARC,NBS
NB-ARC

GMGGIGKTTLAKKLYHNSAVVNKFHRRAWVSVSQDYKTEDLLRRIIKSFRISYSTIELEKMSTEDLERHLHGSLLEHSYLVVLDDVW

HMMPanther: PTHR23155
1-87 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGIGKTTLAKKLYHNSAVVNKFHRRAWVSVSQDYKTEDLLRRIIKSFRISYSTIELEKMSTEDLERHLHGSLLEHSYLVVLDDVW

HMMPanther: PTHR23155:SF121
1-87 PTHR23155:SF121,SUBFAMILY NOT NAMED

GMGGIGKTTLAKKLYHNSAVVNKFHRRAWVSVSQDYKTEDLLRRIIKSFRISYSTIELEKMSTEDLERHLHGSLLEHSYLVVLDDVW

superfamily: SSF52540
1-87 SSF52540

GMGGIGKTTLAKKLYHNSAVVNKFHRRAWVSVSQDYKTEDLLRRIIKSFRISYSTIELEKMSTEDLERHLHGSLLEHSYLVVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox