PRGDB00190542 (Lsa.21618)

From PRG Wiki
Revision as of 11:05, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Lsa.21618
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90500100 (DY961958)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Lactuca sativa

Comment?

CLSM12281.b2_B24.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM12281, mRNA sequence

DNA Sequence

AGAGTTTAAATAATACCTCTGGGAGCCAATTAAGCCATACCTTTATTTCATACTCCCCTCCCCTTTCTGAAATCGATTATGGCGCTGCTGAAACAGTTGGAACACCTCAAAATCTCATTTGATGTCATAAAATTGGCCACTAATAACTTTGGACCTGAGAATTTTATCGGGGTGGGTGGATTCGGCAAGGTCTACAAAGCAGAGATAACTTCCACTGATGGGCTAACAAAAACCGTCGCAATAAAGAGGTTAGACACACGACATGGACAAGGTGAACATGAGTTCCTAATGGAGATAATGATGCTCTCTCGTTATCGACACAAAAACCTAGTCTCTCTCTTAGGTTTCTGTGACGAAGGGGAGGAAAAGATTCTTGTTTATGAGTATGAGCTTAATGGTAGCCTCGAAAAGTACCTTAGCAGCACCACTCTCACATGGGCTCAACGCCTGAAGATATGCATTGGGGCAGCTCGTGGACTGGAGTACCTTCACAACCCACTTGGGACACAACAAAGAGTCTTGCATCGAGATGTGAAAAGCGCGAATGTTCTCTTAGATCAGTTTTGGGAAGCTAAAATAGCCGATTTTGGGTTGTCCAAAATGGGCCCTGCAAATCAAGAGTACACCTTTCTTGTCTCCAATGCAGTTGGAACATTTGGGTATTGTGATCCGTTGTATGCAGAGACAAATATTCTGACAAAGGAGTCGGATGTGTACTCGTTTGGGGCAGTATTGTTTGAAGTCCTTTGTGGGAGGTTGTGCATTGGGAGACCCGATGATAAGCATCGATTATTGACAAAACTCGCACAACAGAGCTATGAA


Protein sequences

Name Description Sequence
Lsa.21618 translated coding region predicted by ESTScan from UniGene Lsa.21618

MALLKQLEHLKISFDVIKLATNNFGPENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRLCIGRPDDKHRLLTKLAQQSYE

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-227 Protein kinase-like (PK-like)
Protein kinase-like domain

MALLKQLEHLKISFDVIKLATNNFGPENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRL

HMMPanther: PTHR24420
11-240 FAMILY NOT NAMED,FAMILY NOT NAMED

KISFDVIKLATNNFGPENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRLCIGRPDDKHRLLT

Gene3D: G3DSA:3.30.200.20
11-89 no description

KISFDVIKLATNNFGPENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLG

ProfileScan: PS50011
IPR000719
24-248 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGPENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRLCIGRPDDKHRLLTKLAQQSYE

HMMSmart: SM00220
IPR002290
24-247 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGPENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRLCIGRPDDKHRLLTKLAQQSY

HMMSmart: SM00219
IPR020635
27-242 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ENFIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRLCIGRPDDKHRLLTKL

HMMPfam: PF07714
IPR001245
29-224 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

FIGVGGFGKVYKAEITSTDGLTKTVAIKRLDTRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLC

PatternScan: PS00107
IPR017441
30-56 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGVGGFGKVYKAEITSTDGLTKTVAIK

Gene3D: G3DSA:1.10.510.10
90-243 no description

FCDEGEEKILVYEYELNGSLEKYLSSTTLTWAQRLKICIGAARGLEYLHNPLGTQQRVLHRDVKSANVLLDQFWEAKIADFGLSKMGPANQEYTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRLCIGRPDDKHRLLTKLA

PatternScan: PS00108
IPR008271
147-159 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDVKSANVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox