PRGDB00194675 (Pgl.29116)

From PRG Wiki
Revision as of 13:20, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.29116
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157556178 (EX357409)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03122.B7_K04 GQ031 - Xylem Scrapings (Normalized library) Picea glauca cDNA clone GQ03122_K04 5', mRNA sequence

DNA Sequence

TCACCATCACTGCTCTCCGGCCATTGTTCATGGCGATCTGAAACCTTCCAACGTTTTATTGGATGAGATGATGAGGGCCCATGTTGGAGTTTTCGGTATTTCACGTCTGATAATCTCGGCAGCAGCGCAGGACGATTCAACAGCAGGATTAGGAAACACCTCAAGCACTGTCATAGGATCTATTGGTTACATTGCACCAGAATATGGTATAGGGGGGCGCCTGTCTCTGAAAGGGGACGTATACAGCTACGGCATCTTGTTGTTGGAAACGATAACGGGAAAGAGGCCCACAGACCCAGTGTTCTCACAAGAAGGGCAATCATGTTCGACATTGCAGAGTTGGGTGGGCGATGCATTCCCCGACAGATTGTTGGAGGTGATTGAGAGGGATCTGGTGGAAGAGATTACACAGGAAGAAGAAGATGAACATGAGTCACATGATTTAAGTGAAACGAGAAATGCAATCAAGGGAAATGGAATTGTTGTTTGGTTGGCAGAGATAGGGATGATGTGCAGCAGAGAAGCGTGGCAGCAGCGACCGACAATGAGAGAGGTCGAGGTATCGTTAGAGCAGTTGGTCGCTAAGATCCTTTAAGGATTTTGAAAATTGGTAGAACAGCATGGTTTATATAGTGTGACTTATATATAACCTCTATTAATGCAATCAGCATTAAATGCAAAAAA


Protein sequences

Name Description Sequence
Pgl.29116 translated coding region predicted by ESTScan from UniGene Pgl.29116

XHHHCSPAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPVFSQEGQSCSTLQSWVGDAFPDRLLEVIERDLVEEITQEEEDEHESHDLSETRNAIKGNGIVVWLAEIGMMCSREAWQQRPTMREVEVSLEQLVAKIL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-147 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XHHHCSPAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPVFSQEGQSCSTLQSWVGDAFPDRLLEVIERDLVEEITQEEEDEHESH

superfamily: SSF56112
IPR011009
2-190 Protein kinase-like (PK-like)
Protein kinase-like domain

HHHCSPAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPVFSQEGQSCSTLQSWVGDAFPDRLLEVIERDLVEEITQEEEDEHESHDLSETRNAIKGNGIVVWLAEIGMMCSREAWQQRPTMREVEVSL

Gene3D: G3DSA:1.10.510.10
2-187 no description

HHHCSPAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPVFSQEGQSCSTLQSWVGDAFPDRLLEVIERDLVEEITQEEEDEHESHDLSETRNAIKGNGIVVWLAEIGMMCSREAWQQRPTMREVE

HMMPanther: PTHR24420:SF474
2-192 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HHHCSPAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPVFSQEGQSCSTLQSWVGDAFPDRLLEVIERDLVEEITQEEEDEHESHDLSETRNAIKGNGIVVWLAEIGMMCSREAWQQRPTMREVEVSLEQ

HMMPanther: PTHR24420
2-192 FAMILY NOT NAMED,FAMILY NOT NAMED

HHHCSPAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPVFSQEGQSCSTLQSWVGDAFPDRLLEVIERDLVEEITQEEEDEHESHDLSETRNAIKGNGIVVWLAEIGMMCSREAWQQRPTMREVEVSLEQ

HMMPfam: PF00069
IPR000719
7-101 Pkinase,Ser-thr
Protein kinase, catalytic domain

PAIVHGDLKPSNVLLDEMMRAHVGVFGISRLIISAAAQDDSTAGLGNTSSTVIGSIGYIAPEYGIGGRLSLKGDVYSYGILLLETITGKRPTDPV

PatternScan: PS00108
IPR008271
9-21 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHGDLKPSNVLL

Seg: seg
134-152 seg

EEITQEEEDEHESHDLSET






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox