PRGDB00194685 (Pgl.29439)

From PRG Wiki
Revision as of 13:21, 7 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Pgl.29439
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 157565262 (EX366490)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Picea glauca

Comment?

GQ03211.B7_L17 GQ032 - Shoot tip (Normalized library) Picea glauca cDNA clone GQ03211_L17 5', mRNA sequence

DNA Sequence

AAATGAGAAGAGTGTATTTTGCAAATCCATCATTTTCCATATATTTAAATGGAAATCCCAACCTTGTGGACCAAAAGTATTTCTCTTATCTACTTGTCCCACAACAAGAGGTCATCCTACAATTGTGAAAAGAGTACTATTGTCATTGAGTGGAGTTGTTGTTTTTATATTATGTTTGTTTTTAATATTCCTATGGAGAAGGAATCAAAACATTGATTACTCAAGAAATATTTTACTTAATGTGGGGCACCAAAAGATCTCATATCAGGAGATTCACATAGCAACTAACAGATTTGCTGAGACGAACTTGCTAGGAGAAGGAAATTCCAGGTTAGTCTATAAAGGAACTTTGATAGATGGCACACTTGTTGCTGTGAAGGTTTTTCAATTGCAAAATGACCAAGACAAGAAGAGTTTTGAAGTAGAGTGTAATATCTTGAAAAAGGTTCGACATAAAAACCTAGTGAGAGTTATAACCTCATACGGTGACATCCATTTCAAATGCTTAGTGTTTGAGTTTATGTCTAATGGAAGCTTAGACAAGCATTTGTATCATAATAGAGATGACAACAATGGTGAGGATGTGTCTGAATTGGGATTGATAACACAATTATACATTGCAAAAAA


Protein sequences

Name Description Sequence
Pgl.29439 translated coding region predicted by ESTScan from UniGene Pgl.29439

XNEKSVFCKSIIFHIFKWKSQPCGPKVFLLSTCPTTRGHPTIVKRVLLSLSGVVVFILCLFLIFLWRRNQNIDYSRNILLNVGHQKISYQEIHIATNRFAETNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYHNRDDNNGEDVSELGLITQLYIAKX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
33-208 FAMILY NOT NAMED,FAMILY NOT NAMED

CPTTRGHPTIVKRVLLSLSGVVVFILCLFLIFLWRRNQNIDYSRNILLNVGHQKISYQEIHIATNRFAETNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYHNRDDNNGEDVSELGLITQLYIA

HMMPanther: PTHR24420:SF474
33-208 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CPTTRGHPTIVKRVLLSLSGVVVFILCLFLIFLWRRNQNIDYSRNILLNVGHQKISYQEIHIATNRFAETNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYHNRDDNNGEDVSELGLITQLYIA

Seg: seg
53-65 seg

VVVFILCLFLIFL

superfamily: SSF56112
IPR011009
69-188 Protein kinase-like (PK-like)
Protein kinase-like domain

NQNIDYSRNILLNVGHQKISYQEIHIATNRFAETNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYHNR

Gene3D: G3DSA:3.30.200.20
89-187 no description

YQEIHIATNRFAETNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYHN

ProfileScan: PS50011
IPR000719
99-210 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAETNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYHNRDDNNGEDVSELGLITQLYIAKX

HMMPfam: PF00069
IPR000719
102-186 Pkinase,Ser-thr
Protein kinase, catalytic domain

TNLLGEGNSRLVYKGTLIDGTLVAVKVFQLQNDQDKKSFEVECNILKKVRHKNLVRVITSYGDIHFKCLVFEFMSNGSLDKHLYH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox