PRGWK00001305 (Sotub02g018270.1.1)

From PRG Wiki
Revision as of 15:04, 15 September 2012 by Cepabot (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search


Sotub02g018270.1.1
Author User:Wasan
Gene Type Contributed R-Genes
Gene Class Class:RLP
Location 2
Location Start 52543833
Location End 52549478
Organism Species:Solanum tuberosum
Approved true



CDS Sequence

ATGGTTTCAATTGATAAGTTGTACAAATTAGTACTATTGCTTATTTTAGCAACCGATATTAGTGTCGTCAAATCGTCGAGTAATTTGGCAAATGGACCTCAGCTGCCCCTTCCAGACGTAGAAGTTAGGGCAGTCGAGGCATTACGTAAACTTGCAAAGGGGAATGACAAGTTCTGGTATCAACAATGTGATAACAAAACTATTATATGTGGCAACTGTAATAAAACATTTTGTCATGTTACGGAAT


Protein Sequences

MVSIDKLYKLVLLLILATDISVVKSSSNLANGPQLPLPDVEVRAVEALRKLAKGNDKFWYQQCDNKTIICGNCNKTFCHVTELYLSGNNLYGRIPQEVGNLSHLTTLDLSGNNLRGEIPISIINLQFITAIDLSDNSLSGQLPPFQMESLQFLGLYENFFSGDLLPFQMNNLQIL


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox